BLASTX nr result
ID: Cnidium21_contig00026749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026749 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520919.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002520919.1| conserved hypothetical protein [Ricinus communis] gi|223539885|gb|EEF41464.1| conserved hypothetical protein [Ricinus communis] Length = 1425 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/48 (50%), Positives = 28/48 (58%) Frame = -3 Query: 434 EGYFRXXXXXXXXXPASFQQSAVNSIPAVPPIPGHNGPQMMPCRPDLS 291 EGYFR FQ S N++PA PIPGH P M+PCRPD+S Sbjct: 1370 EGYFRPPLERPPANNIGFQLSTANNLPAGAPIPGHGVPHMLPCRPDMS 1417