BLASTX nr result
ID: Cnidium21_contig00026659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026659 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_172255.1| cupin domain-containing protein [Arabidopsis th... 119 3e-25 gb|AAM65577.1| globulin-like protein [Arabidopsis thaliana] 119 3e-25 ref|XP_002310124.1| predicted protein [Populus trichocarpa] gi|2... 114 6e-24 ref|XP_002892418.1| hypothetical protein ARALYDRAFT_470808 [Arab... 113 1e-23 ref|XP_002531106.1| nutrient reservoir, putative [Ricinus commun... 111 5e-23 >ref|NP_172255.1| cupin domain-containing protein [Arabidopsis thaliana] gi|8439891|gb|AAF75077.1|AC007583_13 Contains similarity to 12S seed storage globulin precursor gi|134919. ESTs gb|T13642, gb|T21684 and gb|T22751 come from this gene [Arabidopsis thaliana] gi|12248029|gb|AAG50106.1|AF334728_1 putative globulin protein [Arabidopsis thaliana] gi|15294234|gb|AAK95294.1|AF410308_1 At1g07750/F24B9_13 [Arabidopsis thaliana] gi|24111337|gb|AAN46792.1| At1g07750/F24B9_13 [Arabidopsis thaliana] gi|332190055|gb|AEE28176.1| cupin domain-containing protein [Arabidopsis thaliana] Length = 356 Score = 119 bits (297), Expect = 3e-25 Identities = 55/68 (80%), Positives = 61/68 (89%) Frame = +1 Query: 139 MEIDLTPKVAKNVSGGDGGSYSAWCPNDLPMLKQANIGAAKLSLNKNGFALPSYSDSAKV 318 ME+DLTPK+ K V GGDGGSYSAWCP +LPMLKQ NIGAAKL+L KNGFA+P YSDS+KV Sbjct: 1 MELDLTPKLPKKVYGGDGGSYSAWCPEELPMLKQGNIGAAKLALEKNGFAVPRYSDSSKV 60 Query: 319 AYVLQGSG 342 AYVLQGSG Sbjct: 61 AYVLQGSG 68 >gb|AAM65577.1| globulin-like protein [Arabidopsis thaliana] Length = 356 Score = 119 bits (297), Expect = 3e-25 Identities = 55/68 (80%), Positives = 61/68 (89%) Frame = +1 Query: 139 MEIDLTPKVAKNVSGGDGGSYSAWCPNDLPMLKQANIGAAKLSLNKNGFALPSYSDSAKV 318 ME+DLTPK+ K V GGDGGSYSAWCP +LPMLKQ NIGAAKL+L KNGFA+P YSDS+KV Sbjct: 1 MELDLTPKLPKKVYGGDGGSYSAWCPEELPMLKQGNIGAAKLALEKNGFAVPRYSDSSKV 60 Query: 319 AYVLQGSG 342 AYVLQGSG Sbjct: 61 AYVLQGSG 68 >ref|XP_002310124.1| predicted protein [Populus trichocarpa] gi|222853027|gb|EEE90574.1| predicted protein [Populus trichocarpa] Length = 356 Score = 114 bits (286), Expect = 6e-24 Identities = 54/68 (79%), Positives = 60/68 (88%) Frame = +1 Query: 139 MEIDLTPKVAKNVSGGDGGSYSAWCPNDLPMLKQANIGAAKLSLNKNGFALPSYSDSAKV 318 M IDL+PKVAK V GGDGGSY AWCP+DL ML++ NIGAAKL+L KNGFALP YSDSAKV Sbjct: 1 MAIDLSPKVAKKVYGGDGGSYCAWCPSDLAMLREGNIGAAKLALEKNGFALPRYSDSAKV 60 Query: 319 AYVLQGSG 342 AYVLQG+G Sbjct: 61 AYVLQGNG 68 >ref|XP_002892418.1| hypothetical protein ARALYDRAFT_470808 [Arabidopsis lyrata subsp. lyrata] gi|297338260|gb|EFH68677.1| hypothetical protein ARALYDRAFT_470808 [Arabidopsis lyrata subsp. lyrata] Length = 356 Score = 113 bits (283), Expect = 1e-23 Identities = 52/68 (76%), Positives = 60/68 (88%) Frame = +1 Query: 139 MEIDLTPKVAKNVSGGDGGSYSAWCPNDLPMLKQANIGAAKLSLNKNGFALPSYSDSAKV 318 ME+DL+PK+ K V GGDGGSY AWCP +LPMLKQ NIGAAKL+L K+GFA+P YSDS+KV Sbjct: 1 MELDLSPKLPKKVYGGDGGSYFAWCPEELPMLKQGNIGAAKLALEKHGFAIPRYSDSSKV 60 Query: 319 AYVLQGSG 342 AYVLQGSG Sbjct: 61 AYVLQGSG 68 >ref|XP_002531106.1| nutrient reservoir, putative [Ricinus communis] gi|223529302|gb|EEF31271.1| nutrient reservoir, putative [Ricinus communis] Length = 358 Score = 111 bits (278), Expect = 5e-23 Identities = 51/69 (73%), Positives = 62/69 (89%) Frame = +1 Query: 136 EMEIDLTPKVAKNVSGGDGGSYSAWCPNDLPMLKQANIGAAKLSLNKNGFALPSYSDSAK 315 +MEIDL+P++AK V GGDGGSY AWCP++L ML++ NIGAAKL+L K+GFALP YSDSAK Sbjct: 2 KMEIDLSPRLAKKVYGGDGGSYHAWCPSELAMLREGNIGAAKLALEKDGFALPRYSDSAK 61 Query: 316 VAYVLQGSG 342 VAYVLQG+G Sbjct: 62 VAYVLQGNG 70