BLASTX nr result
ID: Cnidium21_contig00026548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026548 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534949.1| conserved hypothetical protein [Ricinus comm... 82 5e-14 ref|XP_002527161.1| cytochrome C oxidase, subunit II, putative [... 63 2e-08 >ref|XP_002534949.1| conserved hypothetical protein [Ricinus communis] gi|223524315|gb|EEF27434.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 82.0 bits (201), Expect = 5e-14 Identities = 42/60 (70%), Positives = 44/60 (73%) Frame = +3 Query: 99 MPSTRALLATNHSLAGRSGSAFQVRYPNRILCSTGSLAPXXXXXXXXXXXXXXXQPLAVI 278 MPSTRALLATNHSLAGR GSAFQVRYPNR+LCSTGSLAP QPLAV+ Sbjct: 1 MPSTRALLATNHSLAGRLGSAFQVRYPNRLLCSTGSLAPSSILSTALLLGSLQLQPLAVL 60 >ref|XP_002527161.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] gi|223533482|gb|EEF35227.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] Length = 139 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 298 EPPEKQAITASGWSSMEPRSKAVDKIEEGARLPVEQRIRLG 176 +PP+KQ ITAS WS EPRSKAVDKI+EGARL VEQR +LG Sbjct: 99 DPPKKQDITASDWSCREPRSKAVDKIKEGARLLVEQRRQLG 139