BLASTX nr result
ID: Cnidium21_contig00026546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026546 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 99 3e-19 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 99 3e-19 ref|NP_001154500.1| TTF-type zinc finger protein with HAT dimeri... 99 4e-19 ref|NP_001154499.1| TTF-type zinc finger protein with HAT dimeri... 99 4e-19 ref|NP_192704.1| uncharacterized protein [Arabidopsis thaliana] ... 97 1e-18 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 99.4 bits (246), Expect = 3e-19 Identities = 50/93 (53%), Positives = 63/93 (67%), Gaps = 2/93 (2%) Frame = +1 Query: 7 IGQKPRRFNPKWFESY-DWLEYSVKVDRVFCLPCYLFNDHVRTQVGGDAFILEGFGAWTK 183 IG+ RRFNPKWF+ Y DWLEYSV+ ++ FCL CYLF D Q G D+F+ GF +W K Sbjct: 105 IGKVLRRFNPKWFDLYGDWLEYSVEKEKAFCLYCYLFRDQTGNQGGSDSFLSTGFCSWNK 164 Query: 184 MQERLRAHIG-EVGSVHNKAIKNFDDLMRQHQS 279 +RL H+G +V S HN A + +DLMRQ QS Sbjct: 165 -ADRLDQHVGLDVNSFHNNAKRKCEDLMRQGQS 196 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 99.4 bits (246), Expect = 3e-19 Identities = 50/93 (53%), Positives = 63/93 (67%), Gaps = 2/93 (2%) Frame = +1 Query: 7 IGQKPRRFNPKWFESY-DWLEYSVKVDRVFCLPCYLFNDHVRTQVGGDAFILEGFGAWTK 183 IG+ RRFNPKWF+ Y DWLEYSV+ ++ FCL CYLF D Q G D+F+ GF +W K Sbjct: 63 IGKVLRRFNPKWFDLYGDWLEYSVEKEKAFCLYCYLFRDQTGNQGGSDSFLSTGFCSWNK 122 Query: 184 MQERLRAHIG-EVGSVHNKAIKNFDDLMRQHQS 279 +RL H+G +V S HN A + +DLMRQ QS Sbjct: 123 -ADRLDQHVGLDVNSFHNNAKRKCEDLMRQGQS 154 >ref|NP_001154500.1| TTF-type zinc finger protein with HAT dimerisation domain [Arabidopsis thaliana] gi|330250920|gb|AEC06014.1| TTF-type zinc finger protein with HAT dimerisation domain [Arabidopsis thaliana] Length = 564 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/87 (54%), Positives = 57/87 (65%), Gaps = 1/87 (1%) Frame = +1 Query: 22 RRFNPKWFESYD-WLEYSVKVDRVFCLPCYLFNDHVRTQVGGDAFILEGFGAWTKMQERL 198 RRFNP WF+ Y WLEYSVK D+ +CL CYLF D++ + G D F +GF W K + L Sbjct: 2 RRFNPDWFDLYSGWLEYSVKKDKAYCLGCYLFRDYLENKSGSDTFATKGFDTW-KNPQSL 60 Query: 199 RAHIGEVGSVHNKAIKNFDDLMRQHQS 279 R H+G V S HN A+K D LMRQ QS Sbjct: 61 REHVGLVNSFHNNALKRADCLMRQGQS 87 >ref|NP_001154499.1| TTF-type zinc finger protein with HAT dimerisation domain [Arabidopsis thaliana] gi|330250919|gb|AEC06013.1| TTF-type zinc finger protein with HAT dimerisation domain [Arabidopsis thaliana] Length = 592 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/87 (54%), Positives = 57/87 (65%), Gaps = 1/87 (1%) Frame = +1 Query: 22 RRFNPKWFESYD-WLEYSVKVDRVFCLPCYLFNDHVRTQVGGDAFILEGFGAWTKMQERL 198 RRFNP WF+ Y WLEYSVK D+ +CL CYLF D++ + G D F +GF W K + L Sbjct: 2 RRFNPDWFDLYSGWLEYSVKKDKAYCLGCYLFRDYLENKSGSDTFATKGFDTW-KNPQSL 60 Query: 199 RAHIGEVGSVHNKAIKNFDDLMRQHQS 279 R H+G V S HN A+K D LMRQ QS Sbjct: 61 REHVGLVNSFHNNALKRADCLMRQGQS 87 >ref|NP_192704.1| uncharacterized protein [Arabidopsis thaliana] gi|4538896|emb|CAB39633.1| putative protein [Arabidopsis thaliana] gi|7267661|emb|CAB78089.1| putative protein [Arabidopsis thaliana] gi|332657378|gb|AEE82778.1| uncharacterized protein [Arabidopsis thaliana] Length = 664 Score = 97.1 bits (240), Expect = 1e-18 Identities = 48/91 (52%), Positives = 62/91 (68%), Gaps = 2/91 (2%) Frame = +1 Query: 4 MIGQKPRRFNPKWFESY-DWLEYSVKVDRVFCLPCYLFNDHVRTQVGGDAFILEGFGAWT 180 +IG+ RRFNPKWF+ Y DWLEYSV+ ++ FCL CYLF D Q G D+F+ GF +W Sbjct: 62 VIGKVLRRFNPKWFDLYGDWLEYSVEKEKAFCLYCYLFRDQAGNQGGSDSFLSTGFCSWN 121 Query: 181 KMQERLRAHIG-EVGSVHNKAIKNFDDLMRQ 270 K +RL H+G +V S HN A + +DLMRQ Sbjct: 122 K-ADRLDQHVGLDVNSFHNNAKRKCEDLMRQ 151