BLASTX nr result
ID: Cnidium21_contig00026400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026400 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278358.1| PREDICTED: uncharacterized protein LOC100241... 100 1e-19 ref|XP_002298011.1| predicted protein [Populus trichocarpa] gi|2... 99 4e-19 ref|XP_002509861.1| conserved hypothetical protein [Ricinus comm... 97 1e-18 ref|NP_198971.1| DET1- and DDB1-associated protein 1 [Arabidopsi... 88 6e-16 ref|XP_002868586.1| hypothetical protein ARALYDRAFT_493832 [Arab... 87 1e-15 >ref|XP_002278358.1| PREDICTED: uncharacterized protein LOC100241601 [Vitis vinifera] gi|297742241|emb|CBI34390.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 100 bits (249), Expect = 1e-19 Identities = 49/66 (74%), Positives = 52/66 (78%) Frame = -2 Query: 303 KMKPITYHPTHNRTLPPPDQVISSEAKNILLRHFYMRAEEKLRSKIATSESLTPEQARKH 124 KM P TYHPTH+RTLPPPDQVIS+E KNILLRHFY RAEEKLR K A SE LTPE K Sbjct: 29 KMIPATYHPTHDRTLPPPDQVISTETKNILLRHFYQRAEEKLRPKRAASEHLTPEHGCKQ 88 Query: 123 SRSSTS 106 R+S S Sbjct: 89 PRASAS 94 >ref|XP_002298011.1| predicted protein [Populus trichocarpa] gi|222845269|gb|EEE82816.1| predicted protein [Populus trichocarpa] Length = 94 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/66 (72%), Positives = 54/66 (81%) Frame = -2 Query: 303 KMKPITYHPTHNRTLPPPDQVISSEAKNILLRHFYMRAEEKLRSKIATSESLTPEQARKH 124 KM P TYHPTH+RTLPPPDQVI++EAKNILLR+FY RAEEKLR K A SE L PE K Sbjct: 29 KMTPATYHPTHSRTLPPPDQVITTEAKNILLRNFYERAEEKLRQKRAASEHLMPEHGCKQ 88 Query: 123 SRSSTS 106 +R+STS Sbjct: 89 ARASTS 94 >ref|XP_002509861.1| conserved hypothetical protein [Ricinus communis] gi|223549760|gb|EEF51248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 97.4 bits (241), Expect = 1e-18 Identities = 47/65 (72%), Positives = 54/65 (83%) Frame = -2 Query: 300 MKPITYHPTHNRTLPPPDQVISSEAKNILLRHFYMRAEEKLRSKIATSESLTPEQARKHS 121 M P TYHPTH+RTLPPPDQVI++EAKNILLR+FY RAEEKLR+K A SE+L PE K Sbjct: 1 MTPATYHPTHSRTLPPPDQVITTEAKNILLRNFYERAEEKLRTKRAASENLIPEHGCKQP 60 Query: 120 RSSTS 106 R+STS Sbjct: 61 RASTS 65 >ref|NP_198971.1| DET1- and DDB1-associated protein 1 [Arabidopsis thaliana] gi|10178010|dbj|BAB11462.1| unnamed protein product [Arabidopsis thaliana] gi|30725336|gb|AAP37690.1| At5g41560 [Arabidopsis thaliana] gi|110736600|dbj|BAF00265.1| hypothetical protein [Arabidopsis thaliana] gi|332007309|gb|AED94692.1| DET1- and DDB1-associated protein 1 [Arabidopsis thaliana] Length = 101 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/66 (62%), Positives = 49/66 (74%) Frame = -2 Query: 303 KMKPITYHPTHNRTLPPPDQVISSEAKNILLRHFYMRAEEKLRSKIATSESLTPEQARKH 124 KM P TY PTHNRTLPPPDQVI++E KNIL+R FY RAEEKLR K ++ L E KH Sbjct: 29 KMVPTTYRPTHNRTLPPPDQVITTEVKNILIRSFYQRAEEKLRPKRPATDHLAAEHVNKH 88 Query: 123 SRSSTS 106 R+++S Sbjct: 89 FRAASS 94 >ref|XP_002868586.1| hypothetical protein ARALYDRAFT_493832 [Arabidopsis lyrata subsp. lyrata] gi|297314422|gb|EFH44845.1| hypothetical protein ARALYDRAFT_493832 [Arabidopsis lyrata subsp. lyrata] Length = 101 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/66 (60%), Positives = 49/66 (74%) Frame = -2 Query: 303 KMKPITYHPTHNRTLPPPDQVISSEAKNILLRHFYMRAEEKLRSKIATSESLTPEQARKH 124 +M P TY PTHNRTLPPPDQVI++E KNIL+R FY RAEEKLR K ++ L E KH Sbjct: 29 RMVPTTYRPTHNRTLPPPDQVITTEVKNILIRSFYQRAEEKLRPKRPATDHLAAEHVNKH 88 Query: 123 SRSSTS 106 R+++S Sbjct: 89 FRAASS 94