BLASTX nr result
ID: Cnidium21_contig00026387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026387 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35009.3| unnamed protein product [Vitis vinifera] 58 7e-07 >emb|CBI35009.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = +3 Query: 3 IGSEDASEAANWNLLIGQSLNDRHGNPWIKPILNP---ENY 116 IGSED +EA WNLLIG++LND++G PW+ P+LNP +NY Sbjct: 115 IGSEDPTEATKWNLLIGKTLNDKYGCPWLTPMLNPISSDNY 155