BLASTX nr result
ID: Cnidium21_contig00026315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026315 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 88 8e-16 emb|CBI20465.3| unnamed protein product [Vitis vinifera] 87 1e-15 ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthe... 87 1e-15 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 87 1e-15 ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Ar... 86 3e-15 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 252 ISLGASINQHKTPCCVKFVPIVELLNSRVVSTYFIPKCPKWILGHKQ 112 ISLGASINQ+KTP CVKF PIVELLNSRVVS+YF PKCPKW+ GHKQ Sbjct: 561 ISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQ 607 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -1 Query: 252 ISLGASINQHKTPCCVKFVPIVELLNSRVVSTYFIPKCPKWILGHKQ 112 ISLGASINQ+KTP CVKF PI+ELLNSRVVS YF PKCPKWI GHKQ Sbjct: 518 ISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQ 564 >ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 2 [Vitis vinifera] Length = 596 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -1 Query: 252 ISLGASINQHKTPCCVKFVPIVELLNSRVVSTYFIPKCPKWILGHKQ 112 ISLGASINQ+KTP CVKF PI+ELLNSRVVS YF PKCPKWI GHKQ Sbjct: 545 ISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQ 591 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -1 Query: 252 ISLGASINQHKTPCCVKFVPIVELLNSRVVSTYFIPKCPKWILGHKQ 112 ISLGASINQ+KTP CVKF PI+ELLNSRVVS YF PKCPKWI GHKQ Sbjct: 562 ISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQ 608 >ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana] gi|62900128|sp|O81829.1|GH35_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.5; AltName: Full=Auxin-responsive GH3-like protein 5; Short=AtGH3-5 gi|3269287|emb|CAA19720.1| GH3 like protein [Arabidopsis thaliana] gi|7269579|emb|CAB79581.1| GH3 like protein [Arabidopsis thaliana] gi|17979055|gb|AAL49795.1| putative GH3 protein [Arabidopsis thaliana] gi|20465961|gb|AAM20166.1| putative GH3 protein [Arabidopsis thaliana] gi|98621984|gb|ABF58888.1| auxin-responsive GH3-like [Arabidopsis thaliana] gi|332659918|gb|AEE85318.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana] Length = 612 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -1 Query: 252 ISLGASINQHKTPCCVKFVPIVELLNSRVVSTYFIPKCPKWILGHKQ 112 ISLGASINQ+KTP CVKF PI+ELLNSRVV +YF PKCPKW+ GHKQ Sbjct: 562 ISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQ 608