BLASTX nr result
ID: Cnidium21_contig00026307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026307 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520123.1| PREDICTED: uncharacterized protein LOC100816... 58 9e-07 ref|XP_004154847.1| PREDICTED: uncharacterized LOC101221326 [Cuc... 57 1e-06 ref|XP_004147855.1| PREDICTED: uncharacterized protein LOC101221... 57 1e-06 gb|ADN34187.1| auxilin-like protein [Cucumis melo subsp. melo] 57 1e-06 emb|CAB16841.1| trichohyalin like protein [Arabidopsis thaliana]... 57 2e-06 >ref|XP_003520123.1| PREDICTED: uncharacterized protein LOC100816942 [Glycine max] Length = 319 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = -1 Query: 279 RAWYFNIRLEAHQRLVKSLDVDVKRWSSGKEGNLRALLSTLQY 151 R W E R+ +SLD DVKRWSSGK GNLRALLSTLQY Sbjct: 207 RDWLVQKEQEHRNRVAESLDADVKRWSSGKTGNLRALLSTLQY 249 >ref|XP_004154847.1| PREDICTED: uncharacterized LOC101221326 [Cucumis sativus] Length = 1442 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 252 EAHQRLVKSLDVDVKRWSSGKEGNLRALLSTLQY 151 E RL +SLD +VKRWSSGKEGNLRALLSTLQY Sbjct: 1339 EERNRLAESLDAEVKRWSSGKEGNLRALLSTLQY 1372 >ref|XP_004147855.1| PREDICTED: uncharacterized protein LOC101221326 [Cucumis sativus] Length = 1457 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 252 EAHQRLVKSLDVDVKRWSSGKEGNLRALLSTLQY 151 E RL +SLD +VKRWSSGKEGNLRALLSTLQY Sbjct: 1354 EERNRLAESLDAEVKRWSSGKEGNLRALLSTLQY 1387 >gb|ADN34187.1| auxilin-like protein [Cucumis melo subsp. melo] Length = 1458 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 252 EAHQRLVKSLDVDVKRWSSGKEGNLRALLSTLQY 151 E RL +SLD +VKRWSSGKEGNLRALLSTLQY Sbjct: 1354 EERNRLAESLDAEVKRWSSGKEGNLRALLSTLQY 1387 >emb|CAB16841.1| trichohyalin like protein [Arabidopsis thaliana] gi|7270600|emb|CAB80318.1| trichohyalin like protein [Arabidopsis thaliana] Length = 1432 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/45 (62%), Positives = 34/45 (75%), Gaps = 6/45 (13%) Frame = -1 Query: 267 FNIRLEAHQR------LVKSLDVDVKRWSSGKEGNLRALLSTLQY 151 + RLE HQR + ++LD +VKRWSSGKEGN+RALLSTLQY Sbjct: 1286 YTSRLERHQRTADRVRIAETLDTEVKRWSSGKEGNIRALLSTLQY 1330