BLASTX nr result
ID: Cnidium21_contig00026141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026141 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI34293.1| Integrase core domain containing protein [Solanum... 75 7e-12 emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera] 69 3e-10 gb|AAC33963.1| contains similarity to reverse transcriptases (Pf... 64 1e-08 emb|CAB40067.1| putative retrotransposon polyprotein [Arabidopsi... 64 1e-08 emb|CAN83808.1| hypothetical protein VITISV_026963 [Vitis vinifera] 64 1e-08 >gb|ABI34293.1| Integrase core domain containing protein [Solanum demissum] Length = 716 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/72 (48%), Positives = 47/72 (65%) Frame = +3 Query: 66 WIVDSGASDHMTPHLSTMIHSTVANSSQQINLPTGATAVISHTGTVVFPSGLTLNKVLCV 245 WIVDSGAS+H+T + ++H ++ ++ LPTG A ISHTG G +L VLCV Sbjct: 194 WIVDSGASNHITGSKNLLLHGDTVGNAGKVQLPTGEFAQISHTGNYSLSGGDSLKDVLCV 253 Query: 246 PSFKHNLLSVQR 281 PSFK NL+SV + Sbjct: 254 PSFKFNLMSVSK 265 >emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera] Length = 1813 Score = 69.3 bits (168), Expect = 3e-10 Identities = 36/84 (42%), Positives = 53/84 (63%), Gaps = 1/84 (1%) Frame = +3 Query: 33 SLSHTNGHSCDWIVDS-GASDHMTPHLSTMIHSTVANSSQQINLPTGATAVISHTGTVVF 209 +L+H+N + D ++ GA+DH+ H+S +N + +NLP G + I+HTGTV+F Sbjct: 630 ALNHSNSGNIDAYANAAGATDHIVSHMSLFTDLKPSNVTT-VNLPNGVASPITHTGTVIF 688 Query: 210 PSGLTLNKVLCVPSFKHNLLSVQR 281 S LTL VLCVPSF NL+S + Sbjct: 689 DSQLTLKDVLCVPSFNLNLISASK 712 >gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, score: 11.19) [Arabidopsis thaliana] Length = 1633 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/70 (47%), Positives = 41/70 (58%) Frame = +3 Query: 66 WIVDSGASDHMTPHLSTMIHSTVANSSQQINLPTGATAVISHTGTVVFPSGLTLNKVLCV 245 WI+DSGAS H+ L TM + S + LP G I+HTGT+ S L L+ VL V Sbjct: 397 WIIDSGASSHVCSDL-TMFRELIHVSGVTVTLPNGTRVAITHTGTICITSTLILHNVLLV 455 Query: 246 PSFKHNLLSV 275 P FK NL+SV Sbjct: 456 PDFKFNLISV 465 >emb|CAB40067.1| putative retrotransposon polyprotein [Arabidopsis thaliana] gi|7267797|emb|CAB81200.1| putative retrotransposon polyprotein [Arabidopsis thaliana] Length = 1203 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/70 (47%), Positives = 41/70 (58%) Frame = +3 Query: 66 WIVDSGASDHMTPHLSTMIHSTVANSSQQINLPTGATAVISHTGTVVFPSGLTLNKVLCV 245 WI+DSGAS H+ L TM + S + LP G I+HTGT+ S L L+ VL V Sbjct: 99 WIIDSGASSHVCSDL-TMFRELIHVSGVTVTLPNGTRVAITHTGTICITSTLILHNVLLV 157 Query: 246 PSFKHNLLSV 275 P FK NL+SV Sbjct: 158 PDFKFNLISV 167 >emb|CAN83808.1| hypothetical protein VITISV_026963 [Vitis vinifera] Length = 971 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/72 (41%), Positives = 43/72 (59%) Frame = +3 Query: 66 WIVDSGASDHMTPHLSTMIHSTVANSSQQINLPTGATAVISHTGTVVFPSGLTLNKVLCV 245 WIVDSGASDHMT +L T +++ + + G + + TG+V+ +TL+ VLCV Sbjct: 330 WIVDSGASDHMTGNLMVFHEYTPCHNNSSVRIADGTLSRVFGTGSVIISKDITLHSVLCV 389 Query: 246 PSFKHNLLSVQR 281 P NLLS+ R Sbjct: 390 PKLDCNLLSISR 401