BLASTX nr result
ID: Cnidium21_contig00026105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026105 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524093.1| conserved hypothetical protein [Ricinus comm... 68 9e-10 >ref|XP_002524093.1| conserved hypothetical protein [Ricinus communis] gi|223536661|gb|EEF38303.1| conserved hypothetical protein [Ricinus communis] Length = 484 Score = 67.8 bits (164), Expect = 9e-10 Identities = 38/92 (41%), Positives = 59/92 (64%), Gaps = 2/92 (2%) Frame = -2 Query: 272 ESKMSNP-GEVSGVNSKNSKTFK-RPTLNKATTMTRKEKPSLTQSRSFPAKGFRASAISK 99 E+K+SN E++ +SKN+K K +P L + +R +KPSL+QS SFPAKG RA + Sbjct: 61 ETKLSNSLKELATPSSKNNKMSKDKPNLKSTASFSRHQKPSLSQSLSFPAKGVRADNMKM 120 Query: 98 SVDAYPTQSSAKHSGASRLKGEARLANGTAAS 3 S+D +PT++ +KH+ KG+ +NG+ S Sbjct: 121 SIDGHPTKTMSKHAKDDGRKGQVN-SNGSGTS 151