BLASTX nr result
ID: Cnidium21_contig00026085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00026085 (512 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 67 2e-09 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 67 2e-09 gb|AFK45340.1| unknown [Medicago truncatula] 64 1e-08 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 77.4 bits (189), Expect = 1e-12 Identities = 38/66 (57%), Positives = 45/66 (68%), Gaps = 7/66 (10%) Frame = +2 Query: 176 WLIMMSSIE------GSRTNTNVFHPKPK-PNSGHFLNNMPRRMPIPFSGPSRRHNDIGL 334 W++++ I GSRT NVF KPK + GHFLN +PR PIP SGPSRRHNDIGL Sbjct: 22 WILLLLFISFFGYCHGSRTTANVFDVKPKNQHRGHFLNFLPRHFPIPTSGPSRRHNDIGL 81 Query: 335 ESWNSP 352 +SW SP Sbjct: 82 QSWRSP 87 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 203 GSRTNTNVFHPKPKPN-SGHFLNNMPRRMPIPFSGPSRRHNDIGLESWNSP 352 GSR+ TNVF+ KPK GHFLN +PR +PIP SGPSRRHN IGL++W SP Sbjct: 29 GSRS-TNVFNFKPKTQYKGHFLNFLPRHLPIPTSGPSRRHNGIGLQNWRSP 78 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/65 (53%), Positives = 44/65 (67%), Gaps = 5/65 (7%) Frame = +2 Query: 173 VWLIMMSSI----EGSRTNTNVFHPKPKP-NSGHFLNNMPRRMPIPFSGPSRRHNDIGLE 337 +WL+++ I GSRT TN F KPK + GHF +P+RM IP+S PSR+HNDIGL Sbjct: 13 IWLLLILFILGQCHGSRT-TNDFKVKPKSEHQGHFFGFLPKRMHIPYSTPSRKHNDIGLR 71 Query: 338 SWNSP 352 SW SP Sbjct: 72 SWRSP 76 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 173 VWLIMMSSIEGSRTNTNVFHPKPK-PNSGHFLNNMPRRMPIPFSGPSRRHNDIGLESWNS 349 ++L + +GSR TNVF KPK + GHF +PRR+PIP+S PSR+HNDIGL+S S Sbjct: 17 LFLCIFGHCDGSRA-TNVFKVKPKYEHKGHFFGFLPRRIPIPYSSPSRKHNDIGLQSLRS 75 Query: 350 P 352 P Sbjct: 76 P 76 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/61 (52%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +2 Query: 173 VWLIMMSSIEGSRTNTNVFHPKPK-PNSGHFLNNMPRRMPIPFSGPSRRHNDIGLESWNS 349 ++L + +GSR TNVF KPK + GHF +P R+PIP+S PSR+HNDIGL+S S Sbjct: 17 LFLCIFGHCDGSRA-TNVFKVKPKYEHKGHFFGFLPGRIPIPYSSPSRKHNDIGLQSLRS 75 Query: 350 P 352 P Sbjct: 76 P 76