BLASTX nr result
ID: Cnidium21_contig00025971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025971 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)aspar... 66 3e-09 ref|XP_002316856.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] gi|223536193|gb|EEF37846.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] Length = 624 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = +1 Query: 1 NVSSSNYTIIYDEENNKCNKRTPTHWGFGLHRWWHNPVRSAFLLSNPL 144 NVSSSNYTI+YD+ NKCNK+ +H GFGL RWW P R A L S L Sbjct: 572 NVSSSNYTILYDKVGNKCNKKEQSHLGFGLSRWWPLPTRRASLASELL 619 >ref|XP_002316856.1| predicted protein [Populus trichocarpa] gi|222859921|gb|EEE97468.1| predicted protein [Populus trichocarpa] Length = 631 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = +1 Query: 1 NVSSSNYTIIYDEENNKCNKRTPTHWGFGLHRWWHNPVRSAFLLSNPLKE 150 N+SSSNYTI+ D N C++R +H GFGL RWW P R A L S L + Sbjct: 577 NISSSNYTILDDNVGNTCSERNHSHLGFGLGRWWQFPARRASLASELLNK 626