BLASTX nr result
ID: Cnidium21_contig00025940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025940 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305222.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 ref|XP_002266602.1| PREDICTED: uncharacterized protein LOC100261... 73 3e-11 emb|CAN71581.1| hypothetical protein VITISV_003231 [Vitis vinifera] 73 3e-11 ref|XP_003517770.1| PREDICTED: transcription factor IIIB 50 kDa ... 72 6e-11 ref|NP_195279.1| zinc ion binding protein [Arabidopsis thaliana]... 72 6e-11 >ref|XP_002305222.1| predicted protein [Populus trichocarpa] gi|222848186|gb|EEE85733.1| predicted protein [Populus trichocarpa] Length = 529 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 284 DVDWEDLIIETLLLHQVKGEEIEKGYYKNLMDLHVFNSGCL 162 D+DWED +IETLLLHQVK EEIEKGYY LMDLHVFNSG + Sbjct: 489 DIDWEDFVIETLLLHQVKEEEIEKGYYNTLMDLHVFNSGTM 529 >ref|XP_002266602.1| PREDICTED: uncharacterized protein LOC100261683 [Vitis vinifera] gi|297740496|emb|CBI30678.3| unnamed protein product [Vitis vinifera] Length = 530 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 302 KKKRHVDVDWEDLIIETLLLHQVKGEEIEKGYYKNLMDLHVFNSGCL 162 +K + +DWED +IETLLLH VK +EIEKG+Y L+DLHVFNSGCL Sbjct: 484 RKTKKNGIDWEDFVIETLLLHHVKEDEIEKGHYNTLLDLHVFNSGCL 530 >emb|CAN71581.1| hypothetical protein VITISV_003231 [Vitis vinifera] Length = 503 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 302 KKKRHVDVDWEDLIIETLLLHQVKGEEIEKGYYKNLMDLHVFNSGCL 162 +K + +DWED +IETLLLH VK +EIEKG+Y L+DLHVFNSGCL Sbjct: 457 RKTKKNGIDWEDFVIETLLLHHVKEDEIEKGHYNTLLDLHVFNSGCL 503 >ref|XP_003517770.1| PREDICTED: transcription factor IIIB 50 kDa subunit-like [Glycine max] Length = 536 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 284 DVDWEDLIIETLLLHQVKGEEIEKGYYKNLMDLHVFNSG 168 DVDWEDLIIETL+LH+VK EEIEKG+Y L+DLHVFNSG Sbjct: 496 DVDWEDLIIETLVLHRVKEEEIEKGHYNTLLDLHVFNSG 534 >ref|NP_195279.1| zinc ion binding protein [Arabidopsis thaliana] gi|3367572|emb|CAA20024.1| putative protein [Arabidopsis thaliana] gi|7270505|emb|CAB80270.1| putative protein [Arabidopsis thaliana] gi|332661128|gb|AEE86528.1| zinc ion binding protein [Arabidopsis thaliana] Length = 527 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -2 Query: 302 KKKRHVDVDWEDLIIETLLLHQVKGEEIEKGYYKNLMDLHVFNSG 168 K+K+ ++DWEDL+I+TL+LH V EEIEKG+YK L+DLHVFNSG Sbjct: 481 KRKKGSEIDWEDLVIQTLVLHNVNEEEIEKGHYKTLLDLHVFNSG 525