BLASTX nr result
ID: Cnidium21_contig00025939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025939 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305222.1| predicted protein [Populus trichocarpa] gi|2... 76 2e-12 ref|XP_003517770.1| PREDICTED: transcription factor IIIB 50 kDa ... 72 4e-11 ref|XP_002266602.1| PREDICTED: uncharacterized protein LOC100261... 72 4e-11 emb|CAN71581.1| hypothetical protein VITISV_003231 [Vitis vinifera] 72 4e-11 ref|XP_002517218.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 >ref|XP_002305222.1| predicted protein [Populus trichocarpa] gi|222848186|gb|EEE85733.1| predicted protein [Populus trichocarpa] Length = 529 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 358 DVDWEDLIIETLLLHQVKEEEIEKGYYKNLMDLHVFDSGCL 236 D+DWED +IETLLLHQVKEEEIEKGYY LMDLHVF+SG + Sbjct: 489 DIDWEDFVIETLLLHQVKEEEIEKGYYNTLMDLHVFNSGTM 529 >ref|XP_003517770.1| PREDICTED: transcription factor IIIB 50 kDa subunit-like [Glycine max] Length = 536 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 358 DVDWEDLIIETLLLHQVKEEEIEKGYYKNLMDLHVFDSG 242 DVDWEDLIIETL+LH+VKEEEIEKG+Y L+DLHVF+SG Sbjct: 496 DVDWEDLIIETLVLHRVKEEEIEKGHYNTLLDLHVFNSG 534 >ref|XP_002266602.1| PREDICTED: uncharacterized protein LOC100261683 [Vitis vinifera] gi|297740496|emb|CBI30678.3| unnamed protein product [Vitis vinifera] Length = 530 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 355 VDWEDLIIETLLLHQVKEEEIEKGYYKNLMDLHVFDSGCL 236 +DWED +IETLLLH VKE+EIEKG+Y L+DLHVF+SGCL Sbjct: 491 IDWEDFVIETLLLHHVKEDEIEKGHYNTLLDLHVFNSGCL 530 >emb|CAN71581.1| hypothetical protein VITISV_003231 [Vitis vinifera] Length = 503 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 355 VDWEDLIIETLLLHQVKEEEIEKGYYKNLMDLHVFDSGCL 236 +DWED +IETLLLH VKE+EIEKG+Y L+DLHVF+SGCL Sbjct: 464 IDWEDFVIETLLLHHVKEDEIEKGHYNTLLDLHVFNSGCL 503 >ref|XP_002517218.1| conserved hypothetical protein [Ricinus communis] gi|223543589|gb|EEF45118.1| conserved hypothetical protein [Ricinus communis] Length = 532 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 355 VDWEDLIIETLLLHQVKEEEIEKGYYKNLMDLHVFDSG 242 +DWED +IETLLLHQVKEEEIEKG+Y L+DLHVF+SG Sbjct: 493 IDWEDFVIETLLLHQVKEEEIEKGHYNTLLDLHVFNSG 530