BLASTX nr result
ID: Cnidium21_contig00025892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025892 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_567943.1| RING/U-box domain-containing protein [Arabidops... 71 8e-11 dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] 71 8e-11 ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arab... 71 8e-11 emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|72703... 71 8e-11 gb|AAM62531.1| unknown [Arabidopsis thaliana] 71 8e-11 >ref|NP_567943.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|63003762|gb|AAY25410.1| At4g33940 [Arabidopsis thaliana] gi|87116618|gb|ABD19673.1| At4g33940 [Arabidopsis thaliana] gi|332660897|gb|AEE86297.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 262 Score = 71.2 bits (173), Expect = 8e-11 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 364 ICFGEFSVPVRTNCGHWFCGSCFFQFWNHKPSLRKCKCPM 483 ICFG F+VP R NCGHW+CG+C Q+WN+ R CKCPM Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNYAAISRPCKCPM 115 >dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] Length = 252 Score = 71.2 bits (173), Expect = 8e-11 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 364 ICFGEFSVPVRTNCGHWFCGSCFFQFWNHKPSLRKCKCPM 483 ICFG F+VP R NCGHW+CG+C Q+WN+ R CKCPM Sbjct: 66 ICFGSFTVPCRGNCGHWYCGNCILQYWNYAAISRPCKCPM 105 >ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] gi|297315020|gb|EFH45443.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] Length = 683 Score = 71.2 bits (173), Expect = 8e-11 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 364 ICFGEFSVPVRTNCGHWFCGSCFFQFWNHKPSLRKCKCPM 483 ICFG F+VP R NCGHW+CG+C Q+WN+ R CKCPM Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNYAAISRPCKCPM 115 >emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|7270343|emb|CAB80111.1| putative protein [Arabidopsis thaliana] Length = 670 Score = 71.2 bits (173), Expect = 8e-11 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 364 ICFGEFSVPVRTNCGHWFCGSCFFQFWNHKPSLRKCKCPM 483 ICFG F+VP R NCGHW+CG+C Q+WN+ R CKCPM Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNYAAISRPCKCPM 115 >gb|AAM62531.1| unknown [Arabidopsis thaliana] Length = 262 Score = 71.2 bits (173), Expect = 8e-11 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 364 ICFGEFSVPVRTNCGHWFCGSCFFQFWNHKPSLRKCKCPM 483 ICFG F+VP R NCGHW+CG+C Q+WN+ R CKCPM Sbjct: 76 ICFGSFTVPCRGNCGHWYCGNCILQYWNYAAISRPCKCPM 115