BLASTX nr result
ID: Cnidium21_contig00025841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025841 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197098.2| Rossmann-fold NAD(P)-binding domain-containing ... 56 3e-06 emb|CAC01793.1| putative protein [Arabidopsis thaliana] 56 3e-06 ref|XP_002871693.1| predicted protein [Arabidopsis lyrata subsp.... 55 5e-06 >ref|NP_197098.2| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] gi|332004843|gb|AED92226.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] Length = 364 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = -3 Query: 323 GSYYFGGSGRTLKSSELSYDKNLAKELWKASCEIFLDAE 207 G+YYFGG GRT++SS++S D LAK+LW+ SC++F D + Sbjct: 320 GAYYFGGKGRTIESSQVSRDPKLAKQLWETSCDLFNDLQ 358 >emb|CAC01793.1| putative protein [Arabidopsis thaliana] Length = 346 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = -3 Query: 323 GSYYFGGSGRTLKSSELSYDKNLAKELWKASCEIFLDAE 207 G+YYFGG GRT++SS++S D LAK+LW+ SC++F D + Sbjct: 302 GAYYFGGKGRTIESSQVSRDPKLAKQLWETSCDLFNDLQ 340 >ref|XP_002871693.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297317530|gb|EFH47952.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 348 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -3 Query: 323 GSYYFGGSGRTLKSSELSYDKNLAKELWKASCEIFLD 213 G+YYFGG GRT++SS++S D LAK+LW+ SC++F D Sbjct: 302 GAYYFGGKGRTIESSQVSRDPRLAKQLWEISCDLFND 338