BLASTX nr result
ID: Cnidium21_contig00025507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025507 (816 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200587.3| uncharacterized protein [Arabidopsis thaliana] ... 60 6e-07 dbj|BAB08849.1| unnamed protein product [Arabidopsis thaliana] 60 6e-07 ref|NP_001032090.1| uncharacterized protein [Arabidopsis thalian... 60 6e-07 ref|XP_002528206.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 ref|XP_002866231.1| hypothetical protein ARALYDRAFT_495875 [Arab... 57 5e-06 >ref|NP_200587.3| uncharacterized protein [Arabidopsis thaliana] gi|332009568|gb|AED96951.1| uncharacterized protein [Arabidopsis thaliana] Length = 216 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 10/106 (9%) Frame = -1 Query: 813 SSMGTVNKIKMKRKTGEKLKKTLKSVISYLRSDSYMYSSLLSN-----KSSDCFSGANTK 649 SS+G K+K K K ++ ++S+++YL+SD+Y+++ L SN D +N+K Sbjct: 7 SSLGARKKLKRK-----KCRRLVRSIVTYLKSDTYLFAPLFSNFPPLTTEIDTPPPSNSK 61 Query: 648 ILSANKGGMETEISANT-----KRRFLHKIVDYLKSDCYMYAPLLA 526 + + ME S KRR K+ +YLKSDCYMY+P+++ Sbjct: 62 PSTVDDISMEGFESLGIEKLIKKRRMSEKVKEYLKSDCYMYSPMIS 107 >dbj|BAB08849.1| unnamed protein product [Arabidopsis thaliana] Length = 229 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 10/106 (9%) Frame = -1 Query: 813 SSMGTVNKIKMKRKTGEKLKKTLKSVISYLRSDSYMYSSLLSN-----KSSDCFSGANTK 649 SS+G K+K K K ++ ++S+++YL+SD+Y+++ L SN D +N+K Sbjct: 7 SSLGARKKLKRK-----KCRRLVRSIVTYLKSDTYLFAPLFSNFPPLTTEIDTPPPSNSK 61 Query: 648 ILSANKGGMETEISANT-----KRRFLHKIVDYLKSDCYMYAPLLA 526 + + ME S KRR K+ +YLKSDCYMY+P+++ Sbjct: 62 PSTVDDISMEGFESLGIEKLIKKRRMSEKVKEYLKSDCYMYSPMIS 107 >ref|NP_001032090.1| uncharacterized protein [Arabidopsis thaliana] gi|48310140|gb|AAT41761.1| At5g57790 [Arabidopsis thaliana] gi|52218790|gb|AAU29465.1| At5g57790 [Arabidopsis thaliana] gi|332009569|gb|AED96952.1| uncharacterized protein [Arabidopsis thaliana] Length = 192 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 10/106 (9%) Frame = -1 Query: 813 SSMGTVNKIKMKRKTGEKLKKTLKSVISYLRSDSYMYSSLLSN-----KSSDCFSGANTK 649 SS+G K+K K K ++ ++S+++YL+SD+Y+++ L SN D +N+K Sbjct: 7 SSLGARKKLKRK-----KCRRLVRSIVTYLKSDTYLFAPLFSNFPPLTTEIDTPPPSNSK 61 Query: 648 ILSANKGGMETEISANT-----KRRFLHKIVDYLKSDCYMYAPLLA 526 + + ME S KRR K+ +YLKSDCYMY+P+++ Sbjct: 62 PSTVDDISMEGFESLGIEKLIKKRRMSEKVKEYLKSDCYMYSPMIS 107 >ref|XP_002528206.1| conserved hypothetical protein [Ricinus communis] gi|223532367|gb|EEF34163.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 58.5 bits (140), Expect = 2e-06 Identities = 37/96 (38%), Positives = 57/96 (59%), Gaps = 8/96 (8%) Frame = -1 Query: 789 IKMKRKTGEKLKKTL-KSVISYLRSDSYMYSSLLSNKS-SDCFSGANTKILSANKGGMET 616 +K ++K + +KTL K V+ YL+SDSY+++ L+S+ +D F + KI+S+ T Sbjct: 9 VKKRKKPIKTNRKTLLKKVVDYLKSDSYLFAPLISSSPRTDHFLAS--KIVSSTSSSTTT 66 Query: 615 ------EISANTKRRFLHKIVDYLKSDCYMYAPLLA 526 E K+RF K+ DYLKSD Y+YAP+ A Sbjct: 67 SAVEMKENMKGKKKRFAEKVGDYLKSDGYLYAPVFA 102 >ref|XP_002866231.1| hypothetical protein ARALYDRAFT_495875 [Arabidopsis lyrata subsp. lyrata] gi|297312066|gb|EFH42490.1| hypothetical protein ARALYDRAFT_495875 [Arabidopsis lyrata subsp. lyrata] Length = 193 Score = 57.0 bits (136), Expect = 5e-06 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 12/108 (11%) Frame = -1 Query: 813 SSMGTVNKIKMKRKTGEKLKKTLKSVISYLRSDSYMYSSLLSNKSSDCFSGANTKILSAN 634 SS+G K+K K+K ++ ++S ++YL+SD+Y+++ L SN + NT S + Sbjct: 7 SSLGARKKLKRKKKN----RRLMRSSVTYLKSDAYLFAPLFSN-FPPLTTEINTPPPSNS 61 Query: 633 KGGMETEISA------------NTKRRFLHKIVDYLKSDCYMYAPLLA 526 K +IS KRR K+ +YLKS+C+MYAP+++ Sbjct: 62 KPSTLDDISMAGFESLGIERVLKKKRRMSEKVKEYLKSECFMYAPMIS 109