BLASTX nr result
ID: Cnidium21_contig00025487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025487 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJK55830.1| hypothetical protein THAOC_24391 [Thalassiosira o... 84 9e-15 ref|XP_001481702.1| ubiquitin UbiA [Aspergillus fumigatus Af293]... 84 9e-15 gb|ADY48201.1| Ubiquitin-60S ribosomal protein L40 [Ascaris suum] 84 1e-14 dbj|GAA88756.1| RNA polymerase I specific transcription initiati... 83 2e-14 gb|EHA26282.1| hypothetical protein ASPNIDRAFT_52026 [Aspergillu... 83 2e-14 >gb|EJK55830.1| hypothetical protein THAOC_24391 [Thalassiosira oceanica] Length = 184 Score = 84.3 bits (207), Expect = 9e-15 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 5/71 (7%) Frame = +2 Query: 35 EYTMQK--TLHLP---HNYYYNASLSLVELARKSNLYKSICRKCYARLPPRATNCRKKKC 199 +Y +QK TLHL Y+ SL+L LA+K N K ICRKCYARLPP+ATNCRKKKC Sbjct: 114 DYNIQKESTLHLVLRLRGGVYDPSLAL--LAKKFNCEKQICRKCYARLPPKATNCRKKKC 171 Query: 200 GHSNQLRPKSK 232 GHS+QLRPK K Sbjct: 172 GHSSQLRPKKK 182 >ref|XP_001481702.1| ubiquitin UbiA [Aspergillus fumigatus Af293] gi|129557008|gb|EBA27335.1| ubiquitin UbiA, putative [Aspergillus fumigatus Af293] gi|159130631|gb|EDP55744.1| ubiquitin UbiA, putative [Aspergillus fumigatus A1163] Length = 142 Score = 84.3 bits (207), Expect = 9e-15 Identities = 46/69 (66%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = +2 Query: 35 EYTMQK--TLHLPHNYYYNA-SLSLVELARKSNLYKSICRKCYARLPPRATNCRKKKCGH 205 +Y +QK TLHL SL LA K N KSICRKCYARLPPRATNCRKKKCGH Sbjct: 72 DYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKKKCGH 131 Query: 206 SNQLRPKSK 232 SNQLRPK K Sbjct: 132 SNQLRPKKK 140 >gb|ADY48201.1| Ubiquitin-60S ribosomal protein L40 [Ascaris suum] Length = 128 Score = 84.0 bits (206), Expect = 1e-14 Identities = 44/70 (62%), Positives = 49/70 (70%), Gaps = 3/70 (4%) Frame = +2 Query: 35 EYTMQK--TLHLPHNYYYNA-SLSLVELARKSNLYKSICRKCYARLPPRATNCRKKKCGH 205 +Y +QK TLHL SL +LA+K N K ICRKCYARLPPRATNCRK+KCGH Sbjct: 58 DYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKQICRKCYARLPPRATNCRKRKCGH 117 Query: 206 SNQLRPKSKH 235 SN LRPK KH Sbjct: 118 SNDLRPKKKH 127 >dbj|GAA88756.1| RNA polymerase I specific transcription initiation factor Rrn7 [Aspergillus kawachii IFO 4308] Length = 605 Score = 83.2 bits (204), Expect = 2e-14 Identities = 45/69 (65%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = +2 Query: 35 EYTMQK--TLHLPHNYYYNA-SLSLVELARKSNLYKSICRKCYARLPPRATNCRKKKCGH 205 +Y +QK TLHL SL LA K N KSICRKCYARLPPRATNCRKKKCGH Sbjct: 535 DYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKKKCGH 594 Query: 206 SNQLRPKSK 232 +NQLRPK K Sbjct: 595 TNQLRPKKK 603 >gb|EHA26282.1| hypothetical protein ASPNIDRAFT_52026 [Aspergillus niger ATCC 1015] Length = 141 Score = 83.2 bits (204), Expect = 2e-14 Identities = 45/69 (65%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = +2 Query: 35 EYTMQK--TLHLPHNYYYNA-SLSLVELARKSNLYKSICRKCYARLPPRATNCRKKKCGH 205 +Y +QK TLHL SL LA K N KSICRKCYARLPPRATNCRKKKCGH Sbjct: 71 DYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKKKCGH 130 Query: 206 SNQLRPKSK 232 +NQLRPK K Sbjct: 131 TNQLRPKKK 139