BLASTX nr result
ID: Cnidium21_contig00025473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025473 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF36333.1| hypothetical protein [Ipomoea trifida] 65 4e-09 gb|AAS79596.1| putative vacuolar assembling protein [Ipomoea tri... 65 4e-09 >dbj|BAF36333.1| hypothetical protein [Ipomoea trifida] Length = 1092 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 6 AASTEEAVSYYEYDNGDAENDASDDGASGAPQMRCILCTTAA 131 AA ++ A SYYEYDNG+A+ D +D +SGAPQMRCILCTTAA Sbjct: 1031 AAPSQGASSYYEYDNGEADEDEDEDTSSGAPQMRCILCTTAA 1072 >gb|AAS79596.1| putative vacuolar assembling protein [Ipomoea trifida] Length = 990 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 6 AASTEEAVSYYEYDNGDAENDASDDGASGAPQMRCILCTTAA 131 AA ++ A SYYEYDNG+A+ D +D +SGAPQMRCILCTTAA Sbjct: 929 AAPSQGASSYYEYDNGEADEDEDEDTSSGAPQMRCILCTTAA 970