BLASTX nr result
ID: Cnidium21_contig00025384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025384 (729 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315377.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 ref|XP_003531757.1| PREDICTED: F-box/kelch-repeat protein At1g51... 56 9e-06 ref|XP_002518834.1| ubiquitin-protein ligase, putative [Ricinus ... 56 9e-06 >ref|XP_002315377.1| predicted protein [Populus trichocarpa] gi|222864417|gb|EEF01548.1| predicted protein [Populus trichocarpa] Length = 469 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 2 LYIFGGMVDGLLQPAEAFSLRFDGEHFLVEL 94 LY+FGGMVDGLLQPAEA+ LRFDGE FLV+L Sbjct: 430 LYVFGGMVDGLLQPAEAYGLRFDGELFLVKL 460 >ref|XP_003531757.1| PREDICTED: F-box/kelch-repeat protein At1g51550-like [Glycine max] Length = 459 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 2 LYIFGGMVDGLLQPAEAFSLRFDGEHFLVELVI 100 LY+FGGMVDG LQPAE LRFDGE FLVELV+ Sbjct: 425 LYVFGGMVDGFLQPAEPSGLRFDGELFLVELVL 457 >ref|XP_002518834.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542007|gb|EEF43552.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 462 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 LYIFGGMVDGLLQPAEAFSLRFDGEHFLVEL 94 LY+FGGMVDG+LQPAEA LRFDGE FLVEL Sbjct: 428 LYVFGGMVDGVLQPAEASGLRFDGELFLVEL 458