BLASTX nr result
ID: Cnidium21_contig00025296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025296 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB52074.1| putative beta-ring carotene hydroxylase [Daucus c... 74 9e-12 sp|B3SGL0.1|BCH_GENLU RecName: Full=Beta-carotene 3-hydroxylase,... 74 9e-12 dbj|BAE92729.1| beta-carotene hydroxylase [Gentiana lutea] 74 9e-12 gb|AAG10430.1| beta hydroxylase [Tagetes erecta] 73 2e-11 ref|NP_001234348.1| beta-carotene hydroxylase [Solanum lycopersi... 73 3e-11 >gb|ABB52074.1| putative beta-ring carotene hydroxylase [Daucus carota subsp. sativus] Length = 309 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 315 VGMEFWARWAHEALCHVSLWHMHESHHKPREG 410 VGMEFWARWAHEAL H SLWHMHESHHKPREG Sbjct: 151 VGMEFWARWAHEALWHASLWHMHESHHKPREG 182 >sp|B3SGL0.1|BCH_GENLU RecName: Full=Beta-carotene 3-hydroxylase, chloroplastic; Short=GenCHYB; Flags: Precursor gi|193795404|gb|ACF21782.1| beta-carotene hydroxylase [Gentiana lutea] Length = 320 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 315 VGMEFWARWAHEALCHVSLWHMHESHHKPREG 410 VGMEFWARWAHEAL H SLWHMHESHHKPREG Sbjct: 167 VGMEFWARWAHEALWHASLWHMHESHHKPREG 198 >dbj|BAE92729.1| beta-carotene hydroxylase [Gentiana lutea] Length = 320 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 315 VGMEFWARWAHEALCHVSLWHMHESHHKPREG 410 VGMEFWARWAHEAL H SLWHMHESHHKPREG Sbjct: 167 VGMEFWARWAHEALWHASLWHMHESHHKPREG 198 >gb|AAG10430.1| beta hydroxylase [Tagetes erecta] Length = 309 Score = 73.2 bits (178), Expect = 2e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 315 VGMEFWARWAHEALCHVSLWHMHESHHKPREG 410 VGME+WARWAHEAL H SLWHMHESHHKPREG Sbjct: 154 VGMEYWARWAHEALWHASLWHMHESHHKPREG 185 >ref|NP_001234348.1| beta-carotene hydroxylase [Solanum lycopersicum] gi|5870598|emb|CAB55625.1| beta-carotene hydroxylase [Solanum lycopersicum] Length = 309 Score = 72.8 bits (177), Expect = 3e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 315 VGMEFWARWAHEALCHVSLWHMHESHHKPREG 410 VGMEFWARWAH+AL H SLWHMHESHHKPREG Sbjct: 155 VGMEFWARWAHKALWHASLWHMHESHHKPREG 186