BLASTX nr result
ID: Cnidium21_contig00025251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025251 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519802.1| conserved hypothetical protein [Ricinus comm... 96 2e-18 ref|XP_002524160.1| conserved hypothetical protein [Ricinus comm... 96 2e-18 ref|XP_002524154.1| conserved hypothetical protein [Ricinus comm... 95 5e-18 ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838... 88 6e-16 ref|XP_003572184.1| PREDICTED: uncharacterized protein LOC100846... 87 2e-15 >ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis] gi|223541041|gb|EEF42598.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 96.3 bits (238), Expect = 2e-18 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -1 Query: 299 SWTMFSTEDPNAAWNLQFSGQYSPTCPYAPQDGSESWHMTGHLCIPKRCC 150 +WTMFSTEDPNA WN+ + Y+P+CPYA DG ESWHMTGHLCIPKRCC Sbjct: 675 TWTMFSTEDPNAEWNMHLTDSYTPSCPYAYPDGGESWHMTGHLCIPKRCC 724 >ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis] gi|223536578|gb|EEF38223.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 96.3 bits (238), Expect = 2e-18 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = -1 Query: 299 SWTMFSTEDPNAAWNLQFSGQYSPTCPYAPQDGSESWHMTGHLCIPKRCC 150 +WTMFSTEDPNA WNL Y+P+CPYA DG ESWHMTGHLCIPKRCC Sbjct: 675 TWTMFSTEDPNATWNLLLKDSYTPSCPYAYPDGGESWHMTGHLCIPKRCC 724 >ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis] gi|223536572|gb|EEF38217.1| conserved hypothetical protein [Ricinus communis] Length = 724 Score = 95.1 bits (235), Expect = 5e-18 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -1 Query: 299 SWTMFSTEDPNAAWNLQFSGQYSPTCPYAPQDGSESWHMTGHLCIPKRCC 150 +WTMFSTEDPNA WNL Y+P+CPYA DG ESWHMTGHLCIP+RCC Sbjct: 675 TWTMFSTEDPNATWNLLLKDSYTPSCPYAYPDGGESWHMTGHLCIPRRCC 724 >ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium distachyon] Length = 752 Score = 88.2 bits (217), Expect = 6e-16 Identities = 37/51 (72%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 296 WTMFSTEDPNAAWNLQFSGQ--YSPTCPYAPQDGSESWHMTGHLCIPKRCC 150 WTMFST+DPNA WN+ Y PTCPYA DG ESWHMTGHLCIPKRCC Sbjct: 702 WTMFSTDDPNAQWNVLVKKDTAYRPTCPYAYPDGGESWHMTGHLCIPKRCC 752 >ref|XP_003572184.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium distachyon] Length = 765 Score = 86.7 bits (213), Expect = 2e-15 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 296 WTMFSTEDPNAAWNL--QFSGQYSPTCPYAPQDGSESWHMTGHLCIPKRCC 150 WTMF+T+DPNA WN+ + Y+P CPYA DG ESWHMTGHLCIPKRCC Sbjct: 715 WTMFATDDPNAQWNVLVKKDAAYTPACPYAYPDGGESWHMTGHLCIPKRCC 765