BLASTX nr result
ID: Cnidium21_contig00025192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025192 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280827.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 62 4e-08 ref|XP_002321381.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 emb|CBI34574.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_002304577.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002518897.1| Protein MYG1, putative [Ricinus communis] gi... 60 2e-07 >ref|XP_002280827.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like [Vitis vinifera] Length = 361 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/43 (62%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +1 Query: 190 FIQNIYFHAQSWLPARSVVMDCLAAKKDVDSSGEIVLL-PLCP 315 F+ N+ FHA+SWLPARS+VM+CLAA+ D+D SGEI++L CP Sbjct: 221 FLDNVRFHAKSWLPARSIVMECLAARMDIDPSGEIMVLNRFCP 263 >ref|XP_002321381.1| predicted protein [Populus trichocarpa] gi|222868377|gb|EEF05508.1| predicted protein [Populus trichocarpa] Length = 361 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 190 FIQNIYFHAQSWLPARSVVMDCLAAKKDVDSSGEI-VLLPLCP 315 F++NI FHA+SWLPARS+VM+CLA+++D+D SGEI VL CP Sbjct: 221 FMENINFHAKSWLPARSIVMECLASREDIDHSGEIMVLTRSCP 263 >emb|CBI34574.3| unnamed protein product [Vitis vinifera] Length = 338 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/43 (62%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +1 Query: 190 FIQNIYFHAQSWLPARSVVMDCLAAKKDVDSSGEIVLL-PLCP 315 F+ N+ FHA+SWLPARS+VM+CLAA+ D+D SGEI++L CP Sbjct: 198 FLDNVRFHAKSWLPARSIVMECLAARMDIDPSGEIMVLNRFCP 240 >ref|XP_002304577.1| predicted protein [Populus trichocarpa] gi|222842009|gb|EEE79556.1| predicted protein [Populus trichocarpa] Length = 345 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 190 FIQNIYFHAQSWLPARSVVMDCLAAKKDVDSSGEI-VLLPLCP 315 F+ N+ FHA+SWLPARS+VM+CLA + DVD SGEI VL CP Sbjct: 205 FLDNVRFHAKSWLPARSIVMECLATRFDVDPSGEIMVLKTFCP 247 >ref|XP_002518897.1| Protein MYG1, putative [Ricinus communis] gi|223541884|gb|EEF43430.1| Protein MYG1, putative [Ricinus communis] Length = 373 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 190 FIQNIYFHAQSWLPARSVVMDCLAAKKDVDSSGEI-VLLPLCP 315 F+ ++++HA+SWLPARS+VM+CL A+ DVD SGEI VL CP Sbjct: 233 FLDSLHYHAKSWLPARSIVMECLEARSDVDPSGEIMVLATFCP 275