BLASTX nr result
ID: Cnidium21_contig00025050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025050 (656 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 69 8e-10 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 67 4e-09 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.9 bits (167), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 475 MGQRIKRFYFVSRDTPQVGFESRVMGDYPARFGE 576 MGQRIKRF FVSRD+PQVGFESRVMGDYPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 66.6 bits (161), Expect = 4e-09 Identities = 42/68 (61%), Positives = 46/68 (67%), Gaps = 7/68 (10%) Frame = -2 Query: 463 ILLPADQAATLLVDKPSFKLLSFGSDKSSPFGRFAQ-------AVFPYLP*RSDSGLRKE 305 +LLPA AA D+ SFK LSFGSDKSSPFGRFAQ FP + +S SGLRKE Sbjct: 1 MLLPASDAAR---DRLSFKPLSFGSDKSSPFGRFAQVRWSSRSVGFPNV--KSCSGLRKE 55 Query: 304 HRPSALNE 281 HRPS LNE Sbjct: 56 HRPSTLNE 63 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.9 bits (141), Expect = 8e-07 Identities = 35/71 (49%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = -3 Query: 654 LTPPWEEPLLSCLIGGASIHQRRLKVLSEPCWIVTHHTALKPNLWC--IPGDKVKAFDPL 481 +T ++ LLS L G SI Q RLKVL EPC I+T++T + C GD VKA DPL Sbjct: 2 VTLSYKNSLLSYLTRGPSIQQCRLKVLCEPCRIITYYTT-HSSQTCDGSQGDNVKALDPL 60 Query: 480 PHTLMRYSSPL 448 PHTL S+P+ Sbjct: 61 PHTLKGSSTPI 71