BLASTX nr result
ID: Cnidium21_contig00025044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00025044 (520 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181316.1| cysteine/histidine-rich C1 domain-containing pr... 42 2e-06 ref|XP_003633597.1| PREDICTED: uncharacterized protein LOC100853... 45 5e-06 ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 47 6e-06 ref|XP_002522096.1| protein binding protein, putative [Ricinus c... 45 6e-06 >ref|NP_181316.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|330254358|gb|AEC09452.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 396 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -2 Query: 159 TKCQFWMHKTCADAPTTFQFQFHHQHPLVLSFSLPRLYHKFKQHCRLCKET 7 T+C + +H CA P+T H QH L L F P H+ K+ C +C E+ Sbjct: 180 TRCDYNLHDHCATCPSTLATFMHPQHELRLVFRGPEHTHQNKRMCDICDES 230 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 349 IEHPAHSQHPLTLIQRPSSFKCDACKVDDNNRDSSYKCTKCQF 221 ++H H HPLT + F CD CK + +Y+CT+C + Sbjct: 145 VQHFTHI-HPLTKVDGYGEFTCDGCKTYGFGK--TYRCTRCDY 184 >ref|XP_003633597.1| PREDICTED: uncharacterized protein LOC100853056 [Vitis vinifera] Length = 226 Score = 44.7 bits (104), Expect(2) = 5e-06 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 5/91 (5%) Frame = -1 Query: 478 CNACFRPLPWDVIQFLYFSSDTDIYVCVKCALFHLQQPLEDPK-IEHPAHSQHPLTLIQR 302 C AC R + ++ Y C+ C + + L P+ I+HP+H H LTL+ Sbjct: 25 CKACDRLI-----------AEQTFYGCIACKYYLHDRCLNLPRWIKHPSHPSHSLTLLPA 73 Query: 301 PS----SFKCDACKVDDNNRDSSYKCTKCQF 221 P+ SF C+AC N+ S C +C+F Sbjct: 74 PTYPSGSFSCNACGSAANSFSKS--CAECEF 102 Score = 30.4 bits (67), Expect(2) = 5e-06 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 156 KCQFWMHKTCADAPTTFQFQFHHQHPLVLSFSLPRLYHKFKQHCRLC 16 +C+F +H C+ P+T H H L L+F P K+ +C C Sbjct: 99 ECEFDLHLHCSSLPSTVLLD-AHPHELKLTFESPYDDEKWVYYCAEC 144 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 32/100 (32%), Positives = 41/100 (41%), Gaps = 6/100 (6%) Frame = -1 Query: 502 SKSLPVYRCNAC-FRPLPWDVIQFLYFSSDTDIYVCVKCAL-FHLQQPLEDPKIEHPAHS 329 ++SL + C+AC +P W +Y C C H+ I HP H Sbjct: 24 AQSLYMNSCSACNLQPSGW-------------MYSCKPCNFTLHISCTQMPTLITHPCHP 70 Query: 328 QHPLTLIQRP----SSFKCDACKVDDNNRDSSYKCTKCQF 221 HPLTL P SF CD C + N +Y CT C F Sbjct: 71 IHPLTLFSTPVYPGGSFNCDGCGLQGNG--FNYHCTTCDF 108 Score = 27.3 bits (59), Expect(2) = 6e-06 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -2 Query: 159 TKCQFWMHKTCADAPTTFQFQFHHQHPLVLSFSLPRLYHKFKQHCRLC 16 T C F +H CA P + Q H H L L+F P Y C +C Sbjct: 104 TTCDFDVHMMCATNPLSLAHQ-SHPHQLNLAFYPP--YQTKGFSCDIC 148 >ref|XP_002522096.1| protein binding protein, putative [Ricinus communis] gi|223538695|gb|EEF40296.1| protein binding protein, putative [Ricinus communis] Length = 240 Score = 44.7 bits (104), Expect(2) = 6e-06 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 5/65 (7%) Frame = -1 Query: 400 CVKCALFHLQQPLEDPK-IEHPAHSQHPLTLIQRPS----SFKCDACKVDDNNRDSSYKC 236 C+ C F Q L P+ ++HP+H H LTL+ P+ S+ C+AC + + S+ C Sbjct: 43 CLSCKHFLHDQCLNLPRWLQHPSHHSHTLTLLPAPTYPCGSYSCNACGIPGGS-SFSFSC 101 Query: 235 TKCQF 221 +C+F Sbjct: 102 AQCEF 106 Score = 30.0 bits (66), Expect(2) = 6e-06 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -2 Query: 156 KCQFWMHKTCADAPTTFQFQFHHQHPLVLSFSLPRLYHKFKQHCRLCKETLN 1 +C+F +H CA P+T H H L L+F C +C E +N Sbjct: 103 QCEFDLHTNCATLPSTVLID-AHSHELTLTFDNFPSDGNISIVCDVCNELVN 153