BLASTX nr result
ID: Cnidium21_contig00024484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00024484 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634391.1| PREDICTED: extended synaptotagmin-2 isoform ... 121 7e-26 ref|XP_003545028.1| PREDICTED: extended synaptotagmin-1-like [Gl... 121 7e-26 ref|XP_002272757.1| PREDICTED: extended synaptotagmin-2 isoform ... 121 7e-26 emb|CAN71066.1| hypothetical protein VITISV_031706 [Vitis vinifera] 121 7e-26 ref|XP_002530822.1| calcium lipid binding protein, putative [Ric... 120 1e-25 >ref|XP_003634391.1| PREDICTED: extended synaptotagmin-2 isoform 2 [Vitis vinifera] Length = 538 Score = 121 bits (303), Expect = 7e-26 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = -2 Query: 218 YIQIDWLNKFIETLWPYLDKAICKTVKTIVQPIIAEQIPKYKIDSVQFEVLSLGSLPPAF 39 Y ++DWLNKFIE +WPYLDKAICKT K I +PIIAEQIPKYKIDSV+FE L+LGSLPP F Sbjct: 68 YDRVDWLNKFIENMWPYLDKAICKTAKNIAKPIIAEQIPKYKIDSVEFEALTLGSLPPTF 127 Query: 38 TGMKVNITEEKE 3 GMKV T+EKE Sbjct: 128 QGMKVYATDEKE 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 477 FQPTHVKNPVVHSLAEQDSKALKTLLPEIPVWIKYPDHDRV 355 FQPT VK+P+V L EQDSK L+ LLPEIP W+K PD+DRV Sbjct: 31 FQPTDVKDPIVRPLVEQDSKTLQRLLPEIPQWVKNPDYDRV 71 >ref|XP_003545028.1| PREDICTED: extended synaptotagmin-1-like [Glycine max] Length = 538 Score = 121 bits (303), Expect = 7e-26 Identities = 55/72 (76%), Positives = 64/72 (88%) Frame = -2 Query: 218 YIQIDWLNKFIETLWPYLDKAICKTVKTIVQPIIAEQIPKYKIDSVQFEVLSLGSLPPAF 39 Y ++DWLNKFIE +WPYLDKAICKT K+I +PIIAEQIPKYKIDSV+FE L+LGSLPP F Sbjct: 68 YDRLDWLNKFIEYMWPYLDKAICKTAKSIAKPIIAEQIPKYKIDSVEFEELNLGSLPPTF 127 Query: 38 TGMKVNITEEKE 3 GMKV +T+EKE Sbjct: 128 QGMKVYVTDEKE 139 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 477 FQPTHVKNPVVHSLAEQDSKALKTLLPEIPVWIKYPDHDRV 355 FQ T VK+PV+ L EQD+K L+ LLPEIP WIK PD+DR+ Sbjct: 31 FQSTDVKDPVIQPLIEQDAKTLQLLLPEIPTWIKNPDYDRL 71 >ref|XP_002272757.1| PREDICTED: extended synaptotagmin-2 isoform 1 [Vitis vinifera] gi|302142694|emb|CBI19897.3| unnamed protein product [Vitis vinifera] Length = 539 Score = 121 bits (303), Expect = 7e-26 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = -2 Query: 218 YIQIDWLNKFIETLWPYLDKAICKTVKTIVQPIIAEQIPKYKIDSVQFEVLSLGSLPPAF 39 Y ++DWLNKFIE +WPYLDKAICKT K I +PIIAEQIPKYKIDSV+FE L+LGSLPP F Sbjct: 68 YDRVDWLNKFIENMWPYLDKAICKTAKNIAKPIIAEQIPKYKIDSVEFEALTLGSLPPTF 127 Query: 38 TGMKVNITEEKE 3 GMKV T+EKE Sbjct: 128 QGMKVYATDEKE 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 477 FQPTHVKNPVVHSLAEQDSKALKTLLPEIPVWIKYPDHDRV 355 FQPT VK+P+V L EQDSK L+ LLPEIP W+K PD+DRV Sbjct: 31 FQPTDVKDPIVRPLVEQDSKTLQRLLPEIPQWVKNPDYDRV 71 >emb|CAN71066.1| hypothetical protein VITISV_031706 [Vitis vinifera] Length = 539 Score = 121 bits (303), Expect = 7e-26 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = -2 Query: 218 YIQIDWLNKFIETLWPYLDKAICKTVKTIVQPIIAEQIPKYKIDSVQFEVLSLGSLPPAF 39 Y ++DWLNKFIE +WPYLDKAICKT K I +PIIAEQIPKYKIDSV+FE L+LGSLPP F Sbjct: 68 YDRVDWLNKFIENMWPYLDKAICKTAKNIAKPIIAEQIPKYKIDSVEFEALTLGSLPPTF 127 Query: 38 TGMKVNITEEKE 3 GMKV T+EKE Sbjct: 128 QGMKVYATDEKE 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 477 FQPTHVKNPVVHSLAEQDSKALKTLLPEIPVWIKYPDHDRV 355 FQPT VK+P+V L EQDSK L+ LLPEIP W+K PD+DRV Sbjct: 31 FQPTDVKDPIVRPLVEQDSKTLQRLLPEIPQWVKNPDYDRV 71 >ref|XP_002530822.1| calcium lipid binding protein, putative [Ricinus communis] gi|223529614|gb|EEF31562.1| calcium lipid binding protein, putative [Ricinus communis] Length = 444 Score = 120 bits (301), Expect = 1e-25 Identities = 54/72 (75%), Positives = 63/72 (87%) Frame = -2 Query: 218 YIQIDWLNKFIETLWPYLDKAICKTVKTIVQPIIAEQIPKYKIDSVQFEVLSLGSLPPAF 39 Y +IDWLNKF+E +WPYLDKAICKT K I PIIAEQIPKYKIDSV+FE L+LG+LPP F Sbjct: 68 YDRIDWLNKFLEYMWPYLDKAICKTAKNIATPIIAEQIPKYKIDSVEFETLTLGTLPPTF 127 Query: 38 TGMKVNITEEKE 3 +GMKV +T+EKE Sbjct: 128 SGMKVYVTDEKE 139 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -1 Query: 477 FQPTHVKNPVVHSLAEQDSKALKTLLPEIPVWIKYPDHDRV 355 FQPT VK P + L E+DS+ L+ +LPEIP+W+K PD+DR+ Sbjct: 31 FQPTDVKEPEIRPLVEEDSETLQRMLPEIPLWVKNPDYDRI 71