BLASTX nr result
ID: Cnidium21_contig00024226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00024226 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71835.1| hypothetical protein VITISV_002916 [Vitis vinifera] 56 4e-06 >emb|CAN71835.1| hypothetical protein VITISV_002916 [Vitis vinifera] Length = 173 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 238 DDTSKLQRELTFCTLQVIYVNPGCEADLDSLVQDTIRLTTSVE 110 D+ + ++ C +VIYV PGCEA+LDSL+QDTIRLTTSV+ Sbjct: 95 DEEKDAEVSISLCIHKVIYVKPGCEANLDSLIQDTIRLTTSVK 137