BLASTX nr result
ID: Cnidium21_contig00023872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023872 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614534.1| Cyclin-L1-1 [Medicago truncatula] gi|3555158... 58 1e-06 ref|XP_004135616.1| PREDICTED: cyclin-L1-1-like [Cucumis sativus... 57 2e-06 ref|XP_003536100.1| PREDICTED: cyclin-L1-1-like [Glycine max] 57 2e-06 ref|NP_001242524.1| uncharacterized protein LOC100820383 [Glycin... 57 2e-06 ref|XP_002529710.1| Cyclin-L2, putative [Ricinus communis] gi|22... 57 2e-06 >ref|XP_003614534.1| Cyclin-L1-1 [Medicago truncatula] gi|355515869|gb|AES97492.1| Cyclin-L1-1 [Medicago truncatula] Length = 428 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/37 (75%), Positives = 30/37 (81%), Gaps = 5/37 (13%) Frame = +1 Query: 427 NLRTSICVRFKSE-----VVYATARRFQGPLPENPPW 522 +LRTS+CVRFKSE VVYA ARRFQ PLPENPPW Sbjct: 182 SLRTSLCVRFKSEIVACGVVYAAARRFQVPLPENPPW 218 >ref|XP_004135616.1| PREDICTED: cyclin-L1-1-like [Cucumis sativus] gi|449485709|ref|XP_004157252.1| PREDICTED: cyclin-L1-1-like [Cucumis sativus] Length = 443 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 5/37 (13%) Frame = +1 Query: 427 NLRTSICVRFKSEVV-----YATARRFQGPLPENPPW 522 +LRT++CVRFKSEVV YA ARRFQ PLPENPPW Sbjct: 182 SLRTTLCVRFKSEVVACGVVYAAARRFQVPLPENPPW 218 >ref|XP_003536100.1| PREDICTED: cyclin-L1-1-like [Glycine max] Length = 448 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 5/37 (13%) Frame = +1 Query: 427 NLRTSICVRFKSEVV-----YATARRFQGPLPENPPW 522 +LRT++CVRFKSEVV YA ARRFQ PLPENPPW Sbjct: 182 SLRTTLCVRFKSEVVACGVVYAAARRFQVPLPENPPW 218 >ref|NP_001242524.1| uncharacterized protein LOC100820383 [Glycine max] gi|255640064|gb|ACU20323.1| unknown [Glycine max] Length = 445 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 5/37 (13%) Frame = +1 Query: 427 NLRTSICVRFKSEVV-----YATARRFQGPLPENPPW 522 +LRT++CVRFKSEVV YA ARRFQ PLPENPPW Sbjct: 182 SLRTTLCVRFKSEVVACGVVYAAARRFQVPLPENPPW 218 >ref|XP_002529710.1| Cyclin-L2, putative [Ricinus communis] gi|223530812|gb|EEF32676.1| Cyclin-L2, putative [Ricinus communis] Length = 446 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 5/37 (13%) Frame = +1 Query: 427 NLRTSICVRFKSEVV-----YATARRFQGPLPENPPW 522 +LRT++CVRFKSEVV YA ARRFQ PLPENPPW Sbjct: 182 SLRTTLCVRFKSEVVACGVVYAAARRFQVPLPENPPW 218