BLASTX nr result
ID: Cnidium21_contig00023800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023800 (1109 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629636.1| hypothetical protein MTR_8g083380 [Medicago ... 48 4e-07 ref|XP_003629606.1| hypothetical protein MTR_8g081560 [Medicago ... 48 4e-07 ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago ... 50 2e-06 ref|XP_003524931.1| PREDICTED: uncharacterized protein LOC100818... 57 8e-06 >ref|XP_003629636.1| hypothetical protein MTR_8g083380 [Medicago truncatula] gi|355523658|gb|AET04112.1| hypothetical protein MTR_8g083380 [Medicago truncatula] Length = 134 Score = 48.1 bits (113), Expect(2) = 4e-07 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 159 YCAMSRCFPFPPPGYEKKPIPEDANIL 79 +CAMSRCFPFPPPGYEKK ++ ++L Sbjct: 22 FCAMSRCFPFPPPGYEKKTRTDEVDLL 48 Score = 33.1 bits (74), Expect(2) = 4e-07 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 271 MVHGQEYSCWFLSLLE 224 MVHGQE+SCWF+ LE Sbjct: 1 MVHGQEHSCWFVPFLE 16 >ref|XP_003629606.1| hypothetical protein MTR_8g081560 [Medicago truncatula] gi|355523628|gb|AET04082.1| hypothetical protein MTR_8g081560 [Medicago truncatula] Length = 134 Score = 48.1 bits (113), Expect(2) = 4e-07 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 159 YCAMSRCFPFPPPGYEKKPIPEDANIL 79 +CAMSRCFPFPPPGYEKK ++ ++L Sbjct: 22 FCAMSRCFPFPPPGYEKKTRTDEVDLL 48 Score = 33.1 bits (74), Expect(2) = 4e-07 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 271 MVHGQEYSCWFLSLLE 224 MVHGQE+SCWF+ LE Sbjct: 1 MVHGQEHSCWFVPFLE 16 >ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago truncatula] gi|355490704|gb|AES71907.1| hypothetical protein MTR_3g084030 [Medicago truncatula] Length = 749 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 159 YCAMSRCFPFPPPGYEKKPIPEDANIL 79 +CAMSRCFPFPPPGYEKK +D ++L Sbjct: 26 FCAMSRCFPFPPPGYEKKSRTDDVDLL 52 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 271 MVHGQEYSCWFLSLLE 224 MVHGQE SCWF LE Sbjct: 1 MVHGQENSCWFDLFLE 16 >ref|XP_003524931.1| PREDICTED: uncharacterized protein LOC100818612 [Glycine max] Length = 60 Score = 57.0 bits (136), Expect = 8e-06 Identities = 31/60 (51%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = -2 Query: 271 MVHGQEYSCWFLSLLEHRLG-LIEAFLFIDSAWFACSEILCNVSLLSISTSRI*KEAYTR 95 MVHGQE+SCWF+ LE LI+A ++ + ILCNV+L SIST+RI KE Y R Sbjct: 1 MVHGQEHSCWFVPFLEQGYWKLIQALSNLEEFYTRRIWILCNVALFSISTTRIWKEGYNR 60