BLASTX nr result
ID: Cnidium21_contig00023791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023791 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148032.1| PREDICTED: RNA-binding protein Musashi homol... 127 2e-27 ref|XP_002523592.1| RNA-binding protein, putative [Ricinus commu... 126 3e-27 ref|NP_568011.1| RNA recognition motif-containing protein [Arabi... 124 1e-26 ref|XP_003517301.1| PREDICTED: DAZ-associated protein 1-like [Gl... 124 2e-26 ref|XP_002866967.1| RNA recognition motif-containing protein [Ar... 123 2e-26 >ref|XP_004148032.1| PREDICTED: RNA-binding protein Musashi homolog 1-like [Cucumis sativus] gi|449502733|ref|XP_004161727.1| PREDICTED: RNA-binding protein Musashi homolog 1-like [Cucumis sativus] Length = 377 Score = 127 bits (318), Expect = 2e-27 Identities = 57/74 (77%), Positives = 71/74 (95%) Frame = -2 Query: 223 DKKLVVLGIPWDIETDGLQDYMARFGELEDCIVMKDRSSGRSRGFGYVTFSTVEDAKSAL 44 D+KLVVLGIPWD++T+GL++YM++FGELEDCIVMK+RS+GRSRGFGYVTF+T EDAK+AL Sbjct: 2 DRKLVVLGIPWDVDTEGLREYMSKFGELEDCIVMKERSTGRSRGFGYVTFATDEDAKNAL 61 Query: 43 ASEHCLGGRMLEVK 2 +SEH LG RM+EVK Sbjct: 62 SSEHFLGNRMMEVK 75 >ref|XP_002523592.1| RNA-binding protein, putative [Ricinus communis] gi|223537154|gb|EEF38787.1| RNA-binding protein, putative [Ricinus communis] Length = 359 Score = 126 bits (317), Expect = 3e-27 Identities = 57/74 (77%), Positives = 70/74 (94%) Frame = -2 Query: 223 DKKLVVLGIPWDIETDGLQDYMARFGELEDCIVMKDRSSGRSRGFGYVTFSTVEDAKSAL 44 D+KLVVLGIPW+++T+GL++YM +FGEL+DCIVMK+RSSGRSRGFGYVTF++ EDAKSAL Sbjct: 2 DRKLVVLGIPWEVDTEGLREYMTKFGELDDCIVMKERSSGRSRGFGYVTFASAEDAKSAL 61 Query: 43 ASEHCLGGRMLEVK 2 +SEH LG RMLEVK Sbjct: 62 SSEHFLGNRMLEVK 75 >ref|NP_568011.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|238481137|ref|NP_001154290.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|15081787|gb|AAK82548.1| AT4g36960/C7A10_400 [Arabidopsis thaliana] gi|23308345|gb|AAN18142.1| At4g36960/C7A10_400 [Arabidopsis thaliana] gi|332661324|gb|AEE86724.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332661325|gb|AEE86725.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 379 Score = 124 bits (311), Expect = 1e-26 Identities = 56/74 (75%), Positives = 69/74 (93%) Frame = -2 Query: 223 DKKLVVLGIPWDIETDGLQDYMARFGELEDCIVMKDRSSGRSRGFGYVTFSTVEDAKSAL 44 ++KLVVLGIPWDI++DGL+DYM++FG+LEDCIVMKDRS+GRSRGFGYVTF++ EDAK+AL Sbjct: 2 ERKLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL 61 Query: 43 ASEHCLGGRMLEVK 2 EH LG R+LEVK Sbjct: 62 KGEHFLGNRILEVK 75 >ref|XP_003517301.1| PREDICTED: DAZ-associated protein 1-like [Glycine max] Length = 362 Score = 124 bits (310), Expect = 2e-26 Identities = 56/76 (73%), Positives = 69/76 (90%) Frame = -2 Query: 229 MSDKKLVVLGIPWDIETDGLQDYMARFGELEDCIVMKDRSSGRSRGFGYVTFSTVEDAKS 50 M +KLVVLGIPWDI+T+GL++YM++FGELEDCIVMK+RS+GRSRGFGYVTF++V+DAK Sbjct: 1 MEQRKLVVLGIPWDIDTEGLREYMSKFGELEDCIVMKERSTGRSRGFGYVTFASVDDAKE 60 Query: 49 ALASEHCLGGRMLEVK 2 L+SEH LG R LEVK Sbjct: 61 VLSSEHILGNRTLEVK 76 >ref|XP_002866967.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312803|gb|EFH43226.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 380 Score = 123 bits (309), Expect = 2e-26 Identities = 56/74 (75%), Positives = 69/74 (93%) Frame = -2 Query: 223 DKKLVVLGIPWDIETDGLQDYMARFGELEDCIVMKDRSSGRSRGFGYVTFSTVEDAKSAL 44 ++KLVVLGIPWDI++DGL+DYM++FG+LEDCIVMKDRS+GRSRGFGYVTF++ EDAK+AL Sbjct: 2 ERKLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASSEDAKNAL 61 Query: 43 ASEHCLGGRMLEVK 2 EH LG R+LEVK Sbjct: 62 KGEHFLGNRILEVK 75