BLASTX nr result
ID: Cnidium21_contig00023714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023714 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-lik... 61 7e-10 gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum] 59 4e-09 gb|ABW24025.1| aux/IAA protein [Eucommia ulmoides] 59 4e-09 ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago... 64 1e-08 gb|ABY48132.1| GH1 protein [Medicago truncatula] 64 1e-08 >ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max] Length = 350 Score = 61.2 bits (147), Expect(2) = 7e-10 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 16 SLFEEGQCGSQSTCGKEMPSESKLRDLLHGSEYVVTYDDKE 138 S F GQCGS G+EM SESKL+DLLHGSEYV+TY+DK+ Sbjct: 266 SCFTLGQCGSHGAPGREMLSESKLKDLLHGSEYVLTYEDKD 306 Score = 26.9 bits (58), Expect(2) = 7e-10 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +2 Query: 2 SMDGAPYLRKVN 37 SMDGAPYLRKV+ Sbjct: 236 SMDGAPYLRKVD 247 >gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum] Length = 357 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 16 SLFEEGQCGSQSTCGKEMPSESKLRDLLHGSEYVVTYDDKE 138 S F GQ GS T G+E+ SESKL+DLLHGSEYV+TY+DK+ Sbjct: 273 SCFTIGQYGSHGTSGRELLSESKLKDLLHGSEYVLTYEDKD 313 Score = 26.9 bits (58), Expect(2) = 4e-09 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +2 Query: 2 SMDGAPYLRKVN 37 SMDGAPYLRKV+ Sbjct: 243 SMDGAPYLRKVD 254 >gb|ABW24025.1| aux/IAA protein [Eucommia ulmoides] Length = 156 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +1 Query: 16 SLFEEGQCGSQSTCGKEMPSESKLRDLLHGSEYVVTYDDKE 138 S F GQC SQ KE SESKLRDLLHGSEYV+TY+DK+ Sbjct: 72 SCFIIGQCASQGASAKEKLSESKLRDLLHGSEYVLTYEDKD 112 Score = 26.9 bits (58), Expect(2) = 4e-09 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +2 Query: 2 SMDGAPYLRKVN 37 SMDGAPYLRKV+ Sbjct: 42 SMDGAPYLRKVD 53 >ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula] gi|355514268|gb|AES95891.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula] Length = 335 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 16 SLFEEGQCGSQSTCGKEMPSESKLRDLLHGSEYVVTYDDKE 138 S F GQCGS GKEM SESKLRDLLHGSEYV+TY+DK+ Sbjct: 251 SCFTLGQCGSHGAPGKEMMSESKLRDLLHGSEYVLTYEDKD 291 >gb|ABY48132.1| GH1 protein [Medicago truncatula] Length = 335 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 16 SLFEEGQCGSQSTCGKEMPSESKLRDLLHGSEYVVTYDDKE 138 S F GQCGS GKEM SESKLRDLLHGSEYV+TY+DK+ Sbjct: 251 SCFTLGQCGSHGAPGKEMMSESKLRDLLHGSEYVLTYEDKD 291