BLASTX nr result
ID: Cnidium21_contig00023692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023692 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173347.1| PREDICTED: tRNA wybutosine-synthesizing prot... 73 3e-11 ref|XP_004152698.1| PREDICTED: tRNA wybutosine-synthesizing prot... 73 3e-11 ref|XP_002510382.1| cytochrome P450, putative [Ricinus communis]... 72 6e-11 gb|AEQ61825.1| flavodoxin family protein [Dimocarpus longan] 71 1e-10 emb|CBI19692.3| unnamed protein product [Vitis vinifera] 70 1e-10 >ref|XP_004173347.1| PREDICTED: tRNA wybutosine-synthesizing protein 1 homolog, partial [Cucumis sativus] Length = 326 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 253 SKDYMAPTPSWAAYGAEEGGFDPKQIRYKKERHHKAK 143 SKDYMAPTPSWA YG++EGGFDP Q RY+KERHHK K Sbjct: 287 SKDYMAPTPSWAVYGSDEGGFDPDQSRYRKERHHKPK 323 >ref|XP_004152698.1| PREDICTED: tRNA wybutosine-synthesizing protein 1 homolog [Cucumis sativus] Length = 640 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 253 SKDYMAPTPSWAAYGAEEGGFDPKQIRYKKERHHKAK 143 SKDYMAPTPSWA YG++EGGFDP Q RY+KERHHK K Sbjct: 601 SKDYMAPTPSWAVYGSDEGGFDPDQSRYRKERHHKPK 637 >ref|XP_002510382.1| cytochrome P450, putative [Ricinus communis] gi|223551083|gb|EEF52569.1| cytochrome P450, putative [Ricinus communis] Length = 630 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 253 SKDYMAPTPSWAAYGAEEGGFDPKQIRYKKERHHKA 146 SKDYMAPTPSWA YGA EGGFDP Q RY+KERHHK+ Sbjct: 593 SKDYMAPTPSWAVYGATEGGFDPDQSRYRKERHHKS 628 >gb|AEQ61825.1| flavodoxin family protein [Dimocarpus longan] Length = 640 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 253 SKDYMAPTPSWAAYGAEEGGFDPKQIRYKKERHHKAK 143 S DYMA TPSWA YGAEEGGFDP Q RY+KERHHK+K Sbjct: 603 SNDYMAATPSWAVYGAEEGGFDPDQSRYRKERHHKSK 639 >emb|CBI19692.3| unnamed protein product [Vitis vinifera] Length = 499 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 253 SKDYMAPTPSWAAYGAEEGGFDPKQIRYKKERHHKAK 143 SKDYMA TPSWA YGAEEGGFDP Q RY+KERHH+ K Sbjct: 460 SKDYMAATPSWAVYGAEEGGFDPGQSRYRKERHHRPK 496