BLASTX nr result
ID: Cnidium21_contig00023518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023518 (1089 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282957.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 ... 79 1e-12 ref|XP_002511411.1| protein binding protein, putative [Ricinus c... 77 7e-12 emb|CAN68092.1| hypothetical protein VITISV_012749 [Vitis vinifera] 75 2e-11 ref|XP_003608971.1| RING finger protein [Medicago truncatula] gi... 65 3e-08 ref|XP_003525499.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-... 63 1e-07 >ref|XP_002282957.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 [Vitis vinifera] Length = 381 Score = 79.3 bits (194), Expect = 1e-12 Identities = 42/67 (62%), Positives = 47/67 (70%) Frame = +2 Query: 554 SPAAVVTAAPYVRTQPPSPSYLLRLQGLLRSVRTENAGPSSNADLTLEAAENGGLLVVMQ 733 S A+VVTA YVR QPPS Y+LRLQG LR VRTENAG ++AD LE AENGGL VV Sbjct: 298 SSASVVTATRYVRVQPPSQGYMLRLQGFLRPVRTENAGAGNDADNALENAENGGLPVVTD 357 Query: 734 PNRSREP 754 + EP Sbjct: 358 DLTNTEP 364 >ref|XP_002511411.1| protein binding protein, putative [Ricinus communis] gi|223550526|gb|EEF52013.1| protein binding protein, putative [Ricinus communis] Length = 381 Score = 77.0 bits (188), Expect = 7e-12 Identities = 45/83 (54%), Positives = 53/83 (63%), Gaps = 4/83 (4%) Frame = +2 Query: 557 PAAVVTAAPYVRTQPPSPSYLLRLQGLLRSVRTENAGPSSNADLTLEAAENGGLLVVMQP 736 PAA VT YVRTQP S SYLLRLQGLLR +RTE+AG SS+ D+ LEA E+G +V + Sbjct: 299 PAADVTTNRYVRTQPSSQSYLLRLQGLLRPIRTEDAGSSSDVDVDLEAVEHGREVVATRE 358 Query: 737 NRSREP----GQTLAERSSPLPH 793 EP G L +SSP H Sbjct: 359 AMVMEPVSLVGSMLVGQSSPPQH 381 >emb|CAN68092.1| hypothetical protein VITISV_012749 [Vitis vinifera] Length = 943 Score = 75.5 bits (184), Expect = 2e-11 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +2 Query: 554 SPAAVVTAAPYVRTQPPSPSYLLRLQGLLRSVRTENAGPSSNADLTLEAAENGGLLV 724 S A+VVTA YVR QPPS Y+LRLQG LR VRTENAG ++AD LE AENGGL V Sbjct: 610 SSASVVTATRYVRVQPPSQGYMLRLQGFLRPVRTENAGAGNDADNALENAENGGLPV 666 >ref|XP_003608971.1| RING finger protein [Medicago truncatula] gi|355510026|gb|AES91168.1| RING finger protein [Medicago truncatula] Length = 365 Score = 65.1 bits (157), Expect = 3e-08 Identities = 37/68 (54%), Positives = 42/68 (61%) Frame = +2 Query: 554 SPAAVVTAAPYVRTQPPSPSYLLRLQGLLRSVRTENAGPSSNADLTLEAAENGGLLVVMQ 733 S +VVT YVR QP S SYLLRLQGLLR VRTE AGP + D L+ AENG V+ Sbjct: 281 SSDSVVTTTRYVRGQPSSQSYLLRLQGLLRPVRTEIAGPVGDTDNALQNAENGVAPVLTT 340 Query: 734 PNRSREPG 757 + PG Sbjct: 341 KCTKQSPG 348 >ref|XP_003525499.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Glycine max] Length = 382 Score = 63.2 bits (152), Expect = 1e-07 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = +2 Query: 554 SPAAVVTAAPYVRTQPPSPSYLLRLQGLLRSVRTENAGPSSNADLTLEAAENGGLLVVMQ 733 S A+VVT YVR QP S SY LRLQGLLR V E AGP + D LE AENG + +V Q Sbjct: 298 SSASVVTTTRYVRGQPSSQSYRLRLQGLLRPVGAEIAGPVGDIDNVLENAENGSVSIVTQ 357