BLASTX nr result
ID: Cnidium21_contig00023451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00023451 (591 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 97 3e-18 ref|XP_004174151.1| PREDICTED: protein ycf2-like, partial [Cucum... 97 3e-18 gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrys... 97 3e-18 ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [... 97 3e-18 ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [... 97 3e-18 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +3 Query: 3 NILVIASTHIPQKVDPAIIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 143 NILVIASTHIPQKVDPA+IAPNKLNTCIKIRRLLIPQQRKHFFTLSY Sbjct: 1774 NILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 1820 >ref|XP_004174151.1| PREDICTED: protein ycf2-like, partial [Cucumis sativus] Length = 345 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +3 Query: 3 NILVIASTHIPQKVDPAIIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 143 NILVIASTHIPQKVDPA+IAPNKLNTCIKIRRLLIPQQRKHFFTLSY Sbjct: 118 NILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 164 >gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2282 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +3 Query: 3 NILVIASTHIPQKVDPAIIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 143 NILVIASTHIPQKVDPA+IAPNKLNTCIKIRRLLIPQQRKHFFTLSY Sbjct: 1760 NILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 1806 >ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|452849111|ref|YP_007474789.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863250|gb|AEX99322.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863266|gb|AEX99338.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863489|gb|AEX99558.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2291 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +3 Query: 3 NILVIASTHIPQKVDPAIIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 143 NILVIASTHIPQKVDPA+IAPNKLNTCIKIRRLLIPQQRKHFFTLSY Sbjct: 1769 NILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 1815 >ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298897|gb|AFA45336.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2282 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +3 Query: 3 NILVIASTHIPQKVDPAIIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 143 NILVIASTHIPQKVDPA+IAPNKLNTCIKIRRLLIPQQRKHFFTLSY Sbjct: 1760 NILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKHFFTLSY 1806