BLASTX nr result
ID: Cnidium21_contig00022951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022951 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137248.1| PREDICTED: anaphase-promoting complex subuni... 57 2e-06 emb|CBI22085.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_004137248.1| PREDICTED: anaphase-promoting complex subunit 5-like [Cucumis sativus] gi|449483128|ref|XP_004156500.1| PREDICTED: anaphase-promoting complex subunit 5-like [Cucumis sativus] Length = 917 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 95 LNLVHFLQYLNSIYHDDYPLALENIHRYFDY 3 L+ VHFL+YLN++YHDDY ALEN+HRYFDY Sbjct: 313 LHRVHFLRYLNTLYHDDYFSALENVHRYFDY 343 >emb|CBI22085.3| unnamed protein product [Vitis vinifera] Length = 921 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -2 Query: 95 LNLVHFLQYLNSIYHDDYPLALENIHRYFDY 3 L+ VHFL+YLN++YH+DYP +LEN+H YFDY Sbjct: 316 LHRVHFLRYLNNLYHNDYPASLENLHCYFDY 346