BLASTX nr result
ID: Cnidium21_contig00022758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022758 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ29023.1| WRKY10 [Panax quinquefolius] 52 2e-07 >gb|AEQ29023.1| WRKY10 [Panax quinquefolius] Length = 292 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 10/58 (17%) Frame = +2 Query: 254 ENELIRILQSHNQQIQSDESKPL---DTTKSVNRTGHARFRRGP-------SVSEPVK 397 E +L+RILQSH QQIQ D K L D+ ++VNRTGHARFRRGP S SEPVK Sbjct: 30 EEQLLRILQSH-QQIQFD-CKDLTVPDSKQAVNRTGHARFRRGPSDPSSSTSQSEPVK 85 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 72 MAIDLINYTKIEDYTAAHESGGS 140 MA+DL+++ ++E + HES GS Sbjct: 1 MAVDLVSFQEMERHIGIHESAGS 23