BLASTX nr result
ID: Cnidium21_contig00022742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022742 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263125.1| PREDICTED: biotin synthase [Vitis vinifera] ... 60 1e-07 emb|CAN60576.1| hypothetical protein VITISV_034772 [Vitis vinifera] 60 1e-07 ref|XP_002529753.1| biotin synthase, putative [Ricinus communis]... 56 3e-06 >ref|XP_002263125.1| PREDICTED: biotin synthase [Vitis vinifera] gi|297743757|emb|CBI36640.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 31/40 (77%) Frame = -3 Query: 349 DFDADQQMFKLLGLIPKAPDFSNDAEGKDFEAENCEVAVS 230 DFDADQQMFKLLGLIPKAP F D K EAENCE AVS Sbjct: 340 DFDADQQMFKLLGLIPKAPSFDEDV-AKTSEAENCEQAVS 378 >emb|CAN60576.1| hypothetical protein VITISV_034772 [Vitis vinifera] Length = 216 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/40 (77%), Positives = 31/40 (77%) Frame = -3 Query: 349 DFDADQQMFKLLGLIPKAPDFSNDAEGKDFEAENCEVAVS 230 DFDADQQMFKLLGLIPKAP F D K EAENCE AVS Sbjct: 175 DFDADQQMFKLLGLIPKAPSFDEDV-AKTSEAENCEQAVS 213 >ref|XP_002529753.1| biotin synthase, putative [Ricinus communis] gi|223530751|gb|EEF32619.1| biotin synthase, putative [Ricinus communis] Length = 375 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 349 DFDADQQMFKLLGLIPKAPDFSNDAEGKDFEAENCEVAVSN 227 DFDADQ MFKLLGLIPKAP F D E + E+ENC+ AVS+ Sbjct: 334 DFDADQLMFKLLGLIPKAPSFPEDEE-RALESENCQEAVSS 373