BLASTX nr result
ID: Cnidium21_contig00022651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022651 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520140.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002322255.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002318727.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 emb|CBI15667.3| unnamed protein product [Vitis vinifera] 55 5e-06 ref|XP_002283774.1| PREDICTED: uncharacterized protein LOC100247... 55 5e-06 >ref|XP_002520140.1| conserved hypothetical protein [Ricinus communis] gi|223540632|gb|EEF42195.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 403 MNNLPTDSDLYKAKRSEALHKYEILLDLEKQLSALYPKPQLLNK 272 +NN+P DSDLY AKR+EAL K+EILL+LEK LS + K Q + K Sbjct: 203 LNNIPKDSDLYLAKRNEALRKFEILLELEKTLSPHFSKAQAIQK 246 >ref|XP_002322255.1| predicted protein [Populus trichocarpa] gi|222869251|gb|EEF06382.1| predicted protein [Populus trichocarpa] Length = 215 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -3 Query: 403 MNNLPTDSDLYKAKRSEALHKYEILLDLEKQLSALYPKPQLLN 275 +NN+P DS+LY AKR+EAL KYEILL+LEK+L+ + K Q +N Sbjct: 172 LNNIPKDSELYVAKRNEALQKYEILLELEKKLTPYFSKCQAVN 214 >ref|XP_002318727.1| predicted protein [Populus trichocarpa] gi|222859400|gb|EEE96947.1| predicted protein [Populus trichocarpa] Length = 253 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -3 Query: 403 MNNLPTDSDLYKAKRSEALHKYEILLDLEKQLSALYPKPQLLN 275 +NN+P DS+LY AKR+EAL KYEILL+LEK+LS + K + +N Sbjct: 210 LNNIPKDSELYVAKRNEALQKYEILLELEKKLSPHFSKREAVN 252 >emb|CBI15667.3| unnamed protein product [Vitis vinifera] Length = 795 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 400 NNLPTDSDLYKAKRSEALHKYEILLDLEKQLSALYPK 290 +NLP D+D Y AKR+EAL K+EIL++LEKQLS L+PK Sbjct: 758 SNLPKDNDAYLAKRNEALRKFEILVELEKQLSTLFPK 794 >ref|XP_002283774.1| PREDICTED: uncharacterized protein LOC100247333 [Vitis vinifera] Length = 226 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 400 NNLPTDSDLYKAKRSEALHKYEILLDLEKQLSALYPK 290 +NLP D+D Y AKR+EAL K+EIL++LEKQLS L+PK Sbjct: 189 SNLPKDNDAYLAKRNEALRKFEILVELEKQLSTLFPK 225