BLASTX nr result
ID: Cnidium21_contig00022574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022574 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598441.1| F-box/kelch-repeat protein [Medicago truncat... 57 2e-06 ref|XP_003609004.1| F-box/kelch-repeat protein [Medicago truncat... 55 8e-06 ref|XP_003608998.1| F-box protein [Medicago truncatula] gi|35551... 55 8e-06 >ref|XP_003598441.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355487489|gb|AES68692.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 413 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/53 (43%), Positives = 36/53 (67%) Frame = -1 Query: 239 KHVRVAGNLPEELTEEILLKVPARYVFNLRRVCKSWNALIITPQFASKHFDVN 81 KH+RV+ LP ++ EIL ++P +++ R VCKSWN+LI P+F K +V+ Sbjct: 36 KHLRVSTTLPSDVIPEILCRLPVKFILQFRCVCKSWNSLISDPKFVKKQLNVS 88 >ref|XP_003609004.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355510059|gb|AES91201.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 515 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/64 (39%), Positives = 39/64 (60%) Frame = -1 Query: 272 SSSITLLYKSMKHVRVAGNLPEELTEEILLKVPARYVFNLRRVCKSWNALIITPQFASKH 93 S ++T+ +S+ + ++PEE+ EILL++P R + R VCK W LI PQFA KH Sbjct: 19 SQNVTVFTQSVSEI--TADMPEEIIVEILLRLPVRSLLQFRCVCKLWKTLISDPQFAKKH 76 Query: 92 FDVN 81 ++ Sbjct: 77 VSIS 80 >ref|XP_003608998.1| F-box protein [Medicago truncatula] gi|355510053|gb|AES91195.1| F-box protein [Medicago truncatula] Length = 607 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/64 (39%), Positives = 39/64 (60%) Frame = -1 Query: 272 SSSITLLYKSMKHVRVAGNLPEELTEEILLKVPARYVFNLRRVCKSWNALIITPQFASKH 93 S ++T+ +S+ + ++PEE+ EILL++P R + R VCK W LI PQFA KH Sbjct: 19 SQNVTVFTQSVSEI--TADMPEEIIVEILLRLPVRSLLQFRCVCKLWKTLISDPQFAKKH 76 Query: 92 FDVN 81 ++ Sbjct: 77 VSIS 80