BLASTX nr result
ID: Cnidium21_contig00022559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022559 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002890893.1| FAD-binding domain-containing protein [Arabi... 83 2e-14 ref|XP_003594612.1| Reticuline oxidase-like protein [Medicago tr... 83 2e-14 ref|NP_193815.2| Reticuline oxidase-like protein [Arabidopsis th... 83 3e-14 ref|XP_003594610.1| Reticuline oxidase-like protein [Medicago tr... 83 3e-14 gb|AEK87147.1| berberine bridge enzyme [Hevea brasiliensis] 82 3e-14 >ref|XP_002890893.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336735|gb|EFH67152.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 537 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -3 Query: 425 DNGKNSYSEGKVYGECYFGPNFDRLVKVKTAVDPENFFRNEQSIPVMPS 279 D+G++SY +G++YG YFG NFDRLV+VKTAVDPENFFRNEQSIP +PS Sbjct: 486 DHGEDSYRKGEIYGRKYFGENFDRLVRVKTAVDPENFFRNEQSIPTLPS 534 >ref|XP_003594612.1| Reticuline oxidase-like protein [Medicago truncatula] gi|355483660|gb|AES64863.1| Reticuline oxidase-like protein [Medicago truncatula] Length = 544 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 419 GKNSYSEGKVYGECYFGPNFDRLVKVKTAVDPENFFRNEQSIPVMP 282 GKNSY EGKVYG YF NFDRLVK+KTAVDP NFFRNEQSIP++P Sbjct: 496 GKNSYQEGKVYGTMYFNNNFDRLVKIKTAVDPGNFFRNEQSIPILP 541 >ref|NP_193815.2| Reticuline oxidase-like protein [Arabidopsis thaliana] gi|118585329|sp|Q9SVG4.2|RETOL_ARATH RecName: Full=Reticuline oxidase-like protein; Flags: Precursor gi|222423132|dbj|BAH19545.1| AT4G20830 [Arabidopsis thaliana] gi|332658965|gb|AEE84365.1| Reticuline oxidase-like protein [Arabidopsis thaliana] Length = 570 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -3 Query: 425 DNGKNSYSEGKVYGECYFGPNFDRLVKVKTAVDPENFFRNEQSIPVMPSPQG 270 D+G NSY EG+VYG YFG NFDRLVK+KTAVDP NFFRNEQSIP + + +G Sbjct: 490 DHGANSYKEGEVYGRKYFGENFDRLVKIKTAVDPGNFFRNEQSIPTLKNEKG 541 >ref|XP_003594610.1| Reticuline oxidase-like protein [Medicago truncatula] gi|355483658|gb|AES64861.1| Reticuline oxidase-like protein [Medicago truncatula] Length = 542 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 419 GKNSYSEGKVYGECYFGPNFDRLVKVKTAVDPENFFRNEQSIPVMP 282 GKNSY EG+VYG YF NFDRLVK+KTAVDP+NFFRNEQSIPV+P Sbjct: 494 GKNSYEEGEVYGTKYFNNNFDRLVKIKTAVDPDNFFRNEQSIPVLP 539 >gb|AEK87147.1| berberine bridge enzyme [Hevea brasiliensis] Length = 539 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -3 Query: 419 GKNSYSEGKVYGECYFGPNFDRLVKVKTAVDPENFFRNEQSIPVMPS 279 GKNSY EG VYG YF NFDRLVKVKTAVDPENFFRNEQSIP +P+ Sbjct: 491 GKNSYEEGSVYGYKYFNGNFDRLVKVKTAVDPENFFRNEQSIPTLPT 537