BLASTX nr result
ID: Cnidium21_contig00022147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022147 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] 55 4e-06 >dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] Length = 988 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 8/71 (11%) Frame = +2 Query: 20 LNENALFLDATGGFDKKKRVYGVGSSQSLFYQSEIVPCTS--------FANEN*KLQQEL 175 ++E+ +FL+A GG DK+ R+YG+GS QS+ Y E TS F E +Q EL Sbjct: 887 VDEDEIFLEAVGGLDKRNRIYGLGSLQSVIYGPESKSSTSTSRYSGSNFNKEYELMQVEL 946 Query: 176 KEMKDRVKDME 208 +EMK++VK+++ Sbjct: 947 QEMKEQVKELQ 957