BLASTX nr result
ID: Cnidium21_contig00022032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00022032 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517432.1| PREDICTED: 21 kDa protein-like [Glycine max] 70 2e-10 ref|XP_002509585.1| 21 kDa protein precursor, putative [Ricinus ... 69 3e-10 gb|ACU15105.1| unknown [Glycine max] 68 7e-10 ref|XP_002329860.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002872657.1| invertase/pectin methylesterase inhibitor fa... 65 8e-09 >ref|XP_003517432.1| PREDICTED: 21 kDa protein-like [Glycine max] Length = 203 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 265 TCSDGFSGNFMEGNVKAVVNRRIVTVAQVTSNALALVNRFAERHEAA 125 TC DGF+G+ M GNVKA++ RIV VAQVTSNALALVNRFA RH +A Sbjct: 153 TCLDGFAGSAMNGNVKALIKDRIVHVAQVTSNALALVNRFASRHPSA 199 >ref|XP_002509585.1| 21 kDa protein precursor, putative [Ricinus communis] gi|223549484|gb|EEF50972.1| 21 kDa protein precursor, putative [Ricinus communis] Length = 198 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -3 Query: 265 TCSDGFSGNFMEGNVKAVVNRRIVTVAQVTSNALALVNRFAERHEAAAT 119 TC DGF+G M+GNVKA + R+ VA+VTSNALALVNRFA RH AA+ Sbjct: 146 TCLDGFAGRHMDGNVKAAIKSRVTNVARVTSNALALVNRFASRHRKAAS 194 >gb|ACU15105.1| unknown [Glycine max] Length = 198 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -3 Query: 265 TCSDGFSGNFMEGNVKAVVNRRIVTVAQVTSNALALVNRFAERH 134 TC DGF+G+ M GNVKA++ RIV VAQVTSNALALVNRFA RH Sbjct: 153 TCLDGFAGSAMNGNVKALIKDRIVHVAQVTSNALALVNRFASRH 196 >ref|XP_002329860.1| predicted protein [Populus trichocarpa] gi|222871097|gb|EEF08228.1| predicted protein [Populus trichocarpa] Length = 94 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -3 Query: 265 TCSDGFSGNFMEGNVKAVVNRRIVTVAQVTSNALALVNRFAERHEA 128 TC DGFS + M+GNVKA + RI VAQVTSNALALV RFA RH A Sbjct: 46 TCLDGFSSHLMDGNVKAAIKLRITNVAQVTSNALALVTRFASRHRA 91 >ref|XP_002872657.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis lyrata subsp. lyrata] gi|297318494|gb|EFH48916.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis lyrata subsp. lyrata] Length = 207 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 265 TCSDGFSGNFMEGNVKAVVNRRIVTVAQVTSNALALVNRFAERHEA 128 TC DGF G M+G VK+ + RR+V VA+VTSNALALVNRFA RH++ Sbjct: 162 TCLDGFDGKVMDGVVKSAIRRRVVHVARVTSNALALVNRFAARHKS 207