BLASTX nr result
ID: Cnidium21_contig00021950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021950 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327569.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 emb|CAJ31282.1| autophagy protein 5 [Saccharum officinarum] 67 1e-09 emb|CAN83659.1| hypothetical protein VITISV_004197 [Vitis vinifera] 67 2e-09 gb|ABR17459.1| unknown [Picea sitchensis] 66 3e-09 ref|XP_002453186.1| hypothetical protein SORBIDRAFT_04g001330 [S... 66 3e-09 >ref|XP_002327569.1| predicted protein [Populus trichocarpa] gi|222836123|gb|EEE74544.1| predicted protein [Populus trichocarpa] Length = 345 Score = 68.2 bits (165), Expect = 7e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 102 LPLLVPQVKPFFSSALPPGVDTVWFDYKGLPLKW 1 LPLL+P +KP+FSS LPPG DT+WFDYKGLPLKW Sbjct: 43 LPLLLPLIKPYFSSTLPPGQDTIWFDYKGLPLKW 76 >emb|CAJ31282.1| autophagy protein 5 [Saccharum officinarum] Length = 369 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 102 LPLLVPQVKPFFSSALPPGVDTVWFDYKGLPLKW 1 LPLL+P +K FSSALPPGVDTVWF+YKGLPLKW Sbjct: 54 LPLLIPVIKAHFSSALPPGVDTVWFEYKGLPLKW 87 >emb|CAN83659.1| hypothetical protein VITISV_004197 [Vitis vinifera] Length = 359 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 102 LPLLVPQVKPFFSSALPPGVDTVWFDYKGLPLKW 1 LPLL+P +KP FSS LPPGVDT+WF+YKGLPLKW Sbjct: 44 LPLLLPLLKPHFSSTLPPGVDTIWFEYKGLPLKW 77 >gb|ABR17459.1| unknown [Picea sitchensis] Length = 266 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 102 LPLLVPQVKPFFSSALPPGVDTVWFDYKGLPLKW 1 LPLL P +KP F S+LPPG DTVWFDYKGLPLKW Sbjct: 51 LPLLTPVIKPHFQSSLPPGTDTVWFDYKGLPLKW 84 >ref|XP_002453186.1| hypothetical protein SORBIDRAFT_04g001330 [Sorghum bicolor] gi|241933017|gb|EES06162.1| hypothetical protein SORBIDRAFT_04g001330 [Sorghum bicolor] Length = 374 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 102 LPLLVPQVKPFFSSALPPGVDTVWFDYKGLPLKW 1 LPLL+P +K FS+ALPPGVDTVWF+YKGLPLKW Sbjct: 54 LPLLIPVIKAHFSNALPPGVDTVWFEYKGLPLKW 87