BLASTX nr result
ID: Cnidium21_contig00021902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021902 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532846.1| DNA binding protein, putative [Ricinus commu... 57 2e-06 ref|XP_002314180.1| methyl binding domain protein [Populus trich... 56 3e-06 >ref|XP_002532846.1| DNA binding protein, putative [Ricinus communis] gi|223527383|gb|EEF29524.1| DNA binding protein, putative [Ricinus communis] Length = 234 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 337 ETPGWLPVGWTITSRTRANGATAGSVDRYYVEPGTGQR 450 ++ WLP GW + R RA+GATAG+VD+YY+EP TG+R Sbjct: 95 DSANWLPPGWLVEDRVRASGATAGTVDKYYIEPVTGRR 132 >ref|XP_002314180.1| methyl binding domain protein [Populus trichocarpa] gi|222850588|gb|EEE88135.1| methyl binding domain protein [Populus trichocarpa] Length = 214 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = +1 Query: 307 RAKKGSEDGGETPGWLPVGWTITSRTRANGATAGSVDRYYVEPGTGQR 450 RAK+ S + WLP GW + R R +GATAG+VD+YY++P +G++ Sbjct: 59 RAKRRSSETTIETSWLPPGWVVEDRIRTSGATAGTVDKYYIDPASGRK 106