BLASTX nr result
ID: Cnidium21_contig00021792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021792 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial... 120 9e-26 ref|XP_002513032.1| diphosphoinositol polyphosphate phosphohydro... 118 4e-25 ref|XP_003546710.1| PREDICTED: nudix hydrolase 16, mitochondrial... 115 5e-24 ref|XP_003542815.1| PREDICTED: nudix hydrolase 16, mitochondrial... 115 5e-24 ref|XP_003627895.1| Nudix hydrolase [Medicago truncatula] gi|355... 114 8e-24 >ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi|147852980|emb|CAN81261.1| hypothetical protein VITISV_019710 [Vitis vinifera] gi|297739943|emb|CBI30125.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 120 bits (302), Expect = 9e-26 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = +1 Query: 76 MSELVARTGRHQQRYVDGYRLIAGCIPFRYRYSKKNDGEPSEKKVEVLMISSTSGPGLLF 255 MSELVARTGRHQQRY DG RL+AGCIPF+YR S +++G S+K VEVLMI+STSGPGLLF Sbjct: 1 MSELVARTGRHQQRYEDGCRLVAGCIPFKYRNSVESNGAASQKIVEVLMINSTSGPGLLF 60 Query: 256 PKGGWENDETVK 291 PKGGWENDETV+ Sbjct: 61 PKGGWENDETVE 72 >ref|XP_002513032.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] gi|223548043|gb|EEF49535.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] Length = 169 Score = 118 bits (296), Expect = 4e-25 Identities = 57/72 (79%), Positives = 62/72 (86%) Frame = +1 Query: 76 MSELVARTGRHQQRYVDGYRLIAGCIPFRYRYSKKNDGEPSEKKVEVLMISSTSGPGLLF 255 MSELVARTGRHQQRY G RL+AGCIPFRYR +ND +EK VEVLMI+STSGPGLLF Sbjct: 1 MSELVARTGRHQQRYEGGCRLVAGCIPFRYRDYDENDDADAEKLVEVLMINSTSGPGLLF 60 Query: 256 PKGGWENDETVK 291 PKGGWENDETV+ Sbjct: 61 PKGGWENDETVE 72 >ref|XP_003546710.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 175 Score = 115 bits (287), Expect = 5e-24 Identities = 54/72 (75%), Positives = 61/72 (84%) Frame = +1 Query: 76 MSELVARTGRHQQRYVDGYRLIAGCIPFRYRYSKKNDGEPSEKKVEVLMISSTSGPGLLF 255 MSELVARTGRHQQRY +GYRL++GC+PFRY+ S SEK VEVLMI+S SGPGLLF Sbjct: 1 MSELVARTGRHQQRYENGYRLVSGCVPFRYKSSNDCGDSSSEKIVEVLMINSPSGPGLLF 60 Query: 256 PKGGWENDETVK 291 PKGGWENDETV+ Sbjct: 61 PKGGWENDETVE 72 >ref|XP_003542815.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 175 Score = 115 bits (287), Expect = 5e-24 Identities = 54/72 (75%), Positives = 61/72 (84%) Frame = +1 Query: 76 MSELVARTGRHQQRYVDGYRLIAGCIPFRYRYSKKNDGEPSEKKVEVLMISSTSGPGLLF 255 MSELVARTGRHQQRY +GYRL++GC+PFRY+ S SEK VEVLMI+S SGPGLLF Sbjct: 1 MSELVARTGRHQQRYENGYRLVSGCVPFRYKSSNDCGDSSSEKIVEVLMINSPSGPGLLF 60 Query: 256 PKGGWENDETVK 291 PKGGWENDETV+ Sbjct: 61 PKGGWENDETVE 72 >ref|XP_003627895.1| Nudix hydrolase [Medicago truncatula] gi|355521917|gb|AET02371.1| Nudix hydrolase [Medicago truncatula] gi|388494930|gb|AFK35531.1| unknown [Medicago truncatula] Length = 175 Score = 114 bits (285), Expect = 8e-24 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +1 Query: 76 MSELVARTGRHQQRYVDGYRLIAGCIPFRYRYSKKNDGEPSEKKVEVLMISSTSGPGLLF 255 MS+LVARTGRHQQRY DGYRL+AGC+PFRY+ +D SEK VEVLMI+S SGPGLLF Sbjct: 1 MSDLVARTGRHQQRYEDGYRLVAGCVPFRYKSC--DDESSSEKIVEVLMINSPSGPGLLF 58 Query: 256 PKGGWENDETVK 291 PKGGWENDETV+ Sbjct: 59 PKGGWENDETVE 70