BLASTX nr result
ID: Cnidium21_contig00021791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021791 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513032.1| diphosphoinositol polyphosphate phosphohydro... 133 1e-29 ref|XP_003627895.1| Nudix hydrolase [Medicago truncatula] gi|355... 128 4e-28 ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial... 128 5e-28 ref|XP_003538246.1| PREDICTED: nudix hydrolase 16, mitochondrial... 127 9e-28 ref|XP_003546710.1| PREDICTED: nudix hydrolase 16, mitochondrial... 125 4e-27 >ref|XP_002513032.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] gi|223548043|gb|EEF49535.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus communis] Length = 169 Score = 133 bits (335), Expect = 1e-29 Identities = 68/83 (81%), Positives = 72/83 (86%), Gaps = 1/83 (1%) Frame = -2 Query: 247 MSELVARTGRLQQRYVDGHRLVAGCIPFRYR-YSEEDDVKSEKNVEVLMITSTSGPGLLF 71 MSELVARTGR QQRY G RLVAGCIPFRYR Y E DD +EK VEVLMI STSGPGLLF Sbjct: 1 MSELVARTGRHQQRYEGGCRLVAGCIPFRYRDYDENDDADAEKLVEVLMINSTSGPGLLF 60 Query: 70 PKGGWENDETVKEAAMREAVEEA 2 PKGGWENDETV+EAA+REA+EEA Sbjct: 61 PKGGWENDETVEEAAVREAIEEA 83 >ref|XP_003627895.1| Nudix hydrolase [Medicago truncatula] gi|355521917|gb|AET02371.1| Nudix hydrolase [Medicago truncatula] gi|388494930|gb|AFK35531.1| unknown [Medicago truncatula] Length = 175 Score = 128 bits (322), Expect = 4e-28 Identities = 64/82 (78%), Positives = 73/82 (89%) Frame = -2 Query: 247 MSELVARTGRLQQRYVDGHRLVAGCIPFRYRYSEEDDVKSEKNVEVLMITSTSGPGLLFP 68 MS+LVARTGR QQRY DG+RLVAGC+PFRY+ S +D+ SEK VEVLMI S SGPGLLFP Sbjct: 1 MSDLVARTGRHQQRYEDGYRLVAGCVPFRYK-SCDDESSSEKIVEVLMINSPSGPGLLFP 59 Query: 67 KGGWENDETVKEAAMREAVEEA 2 KGGWENDETV+EAA+REA+EEA Sbjct: 60 KGGWENDETVEEAAVREAIEEA 81 >ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi|147852980|emb|CAN81261.1| hypothetical protein VITISV_019710 [Vitis vinifera] gi|297739943|emb|CBI30125.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 128 bits (321), Expect = 5e-28 Identities = 66/83 (79%), Positives = 72/83 (86%), Gaps = 1/83 (1%) Frame = -2 Query: 247 MSELVARTGRLQQRYVDGHRLVAGCIPFRYRYS-EEDDVKSEKNVEVLMITSTSGPGLLF 71 MSELVARTGR QQRY DG RLVAGCIPF+YR S E + S+K VEVLMI STSGPGLLF Sbjct: 1 MSELVARTGRHQQRYEDGCRLVAGCIPFKYRNSVESNGAASQKIVEVLMINSTSGPGLLF 60 Query: 70 PKGGWENDETVKEAAMREAVEEA 2 PKGGWENDETV+EAA+REA+EEA Sbjct: 61 PKGGWENDETVEEAALREALEEA 83 >ref|XP_003538246.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 174 Score = 127 bits (319), Expect = 9e-28 Identities = 62/82 (75%), Positives = 71/82 (86%) Frame = -2 Query: 247 MSELVARTGRLQQRYVDGHRLVAGCIPFRYRYSEEDDVKSEKNVEVLMITSTSGPGLLFP 68 M+ELVARTGR QQRY G+RL+AGC+PFRY+ + D SEK VEVLMI STSGPGLLFP Sbjct: 1 MTELVARTGRHQQRYGHGYRLIAGCVPFRYKEDDCGDSCSEKIVEVLMINSTSGPGLLFP 60 Query: 67 KGGWENDETVKEAAMREAVEEA 2 KGGWENDETV+EAA+REA+EEA Sbjct: 61 KGGWENDETVEEAAVREAIEEA 82 >ref|XP_003546710.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Glycine max] Length = 175 Score = 125 bits (314), Expect = 4e-27 Identities = 63/83 (75%), Positives = 72/83 (86%), Gaps = 1/83 (1%) Frame = -2 Query: 247 MSELVARTGRLQQRYVDGHRLVAGCIPFRYRYSEE-DDVKSEKNVEVLMITSTSGPGLLF 71 MSELVARTGR QQRY +G+RLV+GC+PFRY+ S + D SEK VEVLMI S SGPGLLF Sbjct: 1 MSELVARTGRHQQRYENGYRLVSGCVPFRYKSSNDCGDSSSEKIVEVLMINSPSGPGLLF 60 Query: 70 PKGGWENDETVKEAAMREAVEEA 2 PKGGWENDETV++AA+REAVEEA Sbjct: 61 PKGGWENDETVEQAAVREAVEEA 83