BLASTX nr result
ID: Cnidium21_contig00021769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021769 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302805.1| outward rectifying potassium channel [Populu... 88 8e-16 ref|XP_002515189.1| Calcium-activated outward-rectifying potassi... 85 5e-15 ref|XP_002320260.1| outward rectifying potassium channel [Populu... 82 3e-14 ref|XP_003520770.1| PREDICTED: probable calcium-activated outwar... 82 6e-14 emb|CBI37064.3| unnamed protein product [Vitis vinifera] 80 1e-13 >ref|XP_002302805.1| outward rectifying potassium channel [Populus trichocarpa] gi|222844531|gb|EEE82078.1| outward rectifying potassium channel [Populus trichocarpa] Length = 379 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 382 SKSEYVVYKLKEMGKIGEKDILQICDQFNKLDRNNCGKLTLPDLFGRRL 236 SKSEYV+YKLKEMGKIGEKD+LQIC+QF+KLD NN GK+TLPDL G RL Sbjct: 331 SKSEYVIYKLKEMGKIGEKDVLQICNQFSKLDPNNLGKITLPDLLGHRL 379 >ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 390 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -1 Query: 382 SKSEYVVYKLKEMGKIGEKDILQICDQFNKLDRNNCGKLTLPDLFGRRL 236 SKSEYV+YKLKEMGKIGEKDILQIC+QF+KLD NN GK+TLPDL RL Sbjct: 342 SKSEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKITLPDLLENRL 390 >ref|XP_002320260.1| outward rectifying potassium channel [Populus trichocarpa] gi|222861033|gb|EEE98575.1| outward rectifying potassium channel [Populus trichocarpa] Length = 318 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 382 SKSEYVVYKLKEMGKIGEKDILQICDQFNKLDRNNCGKLTLPDL 251 SKSEYV+YKLKEMGKIGEKDILQIC+QF+KLD NN GK+TLPDL Sbjct: 274 SKSEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKITLPDL 317 >ref|XP_003520770.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic-like [Glycine max] Length = 376 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 382 SKSEYVVYKLKEMGKIGEKDILQICDQFNKLDRNNCGKLTLPDLFGRRL 236 SKSEYV++KLKEMGKI EKD+LQICDQF KLD +NCGK+TLP+L G L Sbjct: 328 SKSEYVIFKLKEMGKIQEKDVLQICDQFRKLDPSNCGKITLPNLLGGSL 376 >emb|CBI37064.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -1 Query: 382 SKSEYVVYKLKEMGKIGEKDILQICDQFNKLDRNNCGKLTLPDLFGRRL 236 SKSEYV+YKLKEMGKI E D+LQIC+QFNKLD NN GK+TLPDL L Sbjct: 167 SKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLLENHL 215