BLASTX nr result
ID: Cnidium21_contig00021612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021612 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299551.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 >ref|XP_002299551.1| predicted protein [Populus trichocarpa] gi|222846809|gb|EEE84356.1| predicted protein [Populus trichocarpa] Length = 1373 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/53 (52%), Positives = 41/53 (77%) Frame = +3 Query: 9 ILDISEATRKFTELT*ARYPVTMDS*LGDTYFLVSDPESAGSPPRRAHPPVVA 167 ++D++EAT K+++ + YPVT+ S +YF+VS+PESAGSPPRRA PP+ A Sbjct: 63 VVDVTEATNKYSDES--AYPVTIHSQTRSSYFVVSEPESAGSPPRRAPPPLYA 113