BLASTX nr result
ID: Cnidium21_contig00021583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021583 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322129.1| calcium dependent protein kinase 28 [Populus... 114 4e-25 gb|ABY28389.1| calcium-dependent protein kinase 1 [Datura metel] 110 8e-24 ref|XP_002266733.1| PREDICTED: calcium-dependent protein kinase ... 108 1e-23 ref|XP_002511506.1| calcium-dependent protein kinase, putative [... 110 1e-23 gb|AEW69807.1| Hop-interacting protein THI080 [Solanum lycopersi... 109 1e-23 >ref|XP_002322129.1| calcium dependent protein kinase 28 [Populus trichocarpa] gi|222869125|gb|EEF06256.1| calcium dependent protein kinase 28 [Populus trichocarpa] Length = 562 Score = 114 bits (286), Expect(2) = 4e-25 Identities = 54/64 (84%), Positives = 60/64 (93%) Frame = +2 Query: 2 FFDKNGNGYIELDELRDALADGSGETDDDVLHEIMQEVDTDKDGQISYDEFVAMMKAGTD 181 FFDK+GNGYIELDELR+ LAD GETDDDVL++IM+EVDTDKDG ISY+EFVAMMKAGTD Sbjct: 464 FFDKDGNGYIELDELREGLADEYGETDDDVLNDIMREVDTDKDGCISYEEFVAMMKAGTD 523 Query: 182 WRKA 193 WRKA Sbjct: 524 WRKA 527 Score = 25.0 bits (53), Expect(2) = 4e-25 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 280 GSLHLQDTVTGQTYVV 327 GSLHL D +TGQ+ V Sbjct: 547 GSLHLHDALTGQSVAV 562 >gb|ABY28389.1| calcium-dependent protein kinase 1 [Datura metel] Length = 538 Score = 110 bits (274), Expect(2) = 8e-24 Identities = 52/64 (81%), Positives = 58/64 (90%) Frame = +2 Query: 2 FFDKNGNGYIELDELRDALADGSGETDDDVLHEIMQEVDTDKDGQISYDEFVAMMKAGTD 181 FFDK+G+GYIELDEL++ALAD SG D DVL+EIM EVDTDKDGQISY+EFVAMMK GTD Sbjct: 440 FFDKDGSGYIELDELQEALADESGACDTDVLNEIMSEVDTDKDGQISYEEFVAMMKTGTD 499 Query: 182 WRKA 193 WRKA Sbjct: 500 WRKA 503 Score = 25.0 bits (53), Expect(2) = 8e-24 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 280 GSLHLQDTVTGQTYVV 327 GSL LQD ++GQT +V Sbjct: 523 GSLQLQDVLSGQTVIV 538 >ref|XP_002266733.1| PREDICTED: calcium-dependent protein kinase 30 [Vitis vinifera] Length = 552 Score = 108 bits (269), Expect(2) = 1e-23 Identities = 50/64 (78%), Positives = 60/64 (93%) Frame = +2 Query: 2 FFDKNGNGYIELDELRDALADGSGETDDDVLHEIMQEVDTDKDGQISYDEFVAMMKAGTD 181 FFDK+GNG+I+L EL++ALAD SGETD DV++EIM+EVDTDKDG+I+YDEFVAMMK GTD Sbjct: 454 FFDKDGNGFIDLIELQEALADESGETDADVVNEIMREVDTDKDGRINYDEFVAMMKTGTD 513 Query: 182 WRKA 193 WRKA Sbjct: 514 WRKA 517 Score = 26.2 bits (56), Expect(2) = 1e-23 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 280 GSLHLQDTVTGQTYVV 327 GSLHL+D +TGQ+ V Sbjct: 537 GSLHLEDRITGQSIAV 552 >ref|XP_002511506.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223550621|gb|EEF52108.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 549 Score = 110 bits (276), Expect(2) = 1e-23 Identities = 51/64 (79%), Positives = 60/64 (93%) Frame = +2 Query: 2 FFDKNGNGYIELDELRDALADGSGETDDDVLHEIMQEVDTDKDGQISYDEFVAMMKAGTD 181 FFDK+G+GYIEL+ELR+ALAD GETD+DVLH+I++EVDTDKDG ISY+EFV MMKAGTD Sbjct: 451 FFDKDGSGYIELEELREALADEYGETDNDVLHDILREVDTDKDGCISYEEFVVMMKAGTD 510 Query: 182 WRKA 193 WRKA Sbjct: 511 WRKA 514 Score = 23.5 bits (49), Expect(2) = 1e-23 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 280 GSLHLQDTVTGQTYVV 327 GSL L D +TGQ Y V Sbjct: 534 GSLQLHDGLTGQCYAV 549 >gb|AEW69807.1| Hop-interacting protein THI080 [Solanum lycopersicum] Length = 538 Score = 109 bits (272), Expect(2) = 1e-23 Identities = 51/64 (79%), Positives = 59/64 (92%) Frame = +2 Query: 2 FFDKNGNGYIELDELRDALADGSGETDDDVLHEIMQEVDTDKDGQISYDEFVAMMKAGTD 181 FFDK+G+GYIELDELR+ALAD SG D DV++EIM+EVDTDKDGQIS++EFV MMKAGTD Sbjct: 440 FFDKDGSGYIELDELREALADESGACDTDVVNEIMREVDTDKDGQISFEEFVGMMKAGTD 499 Query: 182 WRKA 193 WRKA Sbjct: 500 WRKA 503 Score = 25.0 bits (53), Expect(2) = 1e-23 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 280 GSLHLQDTVTGQTYVV 327 GSL LQD ++GQT +V Sbjct: 523 GSLQLQDVLSGQTVIV 538