BLASTX nr result
ID: Cnidium21_contig00021524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00021524 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276076.2| PREDICTED: BTB/POZ domain-containing protein... 75 6e-12 emb|CBI34431.3| unnamed protein product [Vitis vinifera] 75 6e-12 emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera] 75 6e-12 ref|XP_002509901.1| atpob1, putative [Ricinus communis] gi|22354... 74 2e-11 emb|CBI40464.3| unnamed protein product [Vitis vinifera] 70 2e-10 >ref|XP_002276076.2| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis vinifera] Length = 722 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -3 Query: 352 DDLQVASKDVFYDLVLKWARIHYPKLEEEERQEILGQRLSRVIRFPY 212 DDLQVAS+D YD VLKWARIHYPKL E+R+EILG RL R+IRFPY Sbjct: 307 DDLQVASEDAVYDFVLKWARIHYPKL--EDRREILGSRLGRLIRFPY 351 >emb|CBI34431.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -3 Query: 352 DDLQVASKDVFYDLVLKWARIHYPKLEEEERQEILGQRLSRVIRFPY 212 DDLQVAS+D YD VLKWARIHYPKL E+R+EILG RL R+IRFPY Sbjct: 359 DDLQVASEDAVYDFVLKWARIHYPKL--EDRREILGSRLGRLIRFPY 403 >emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera] Length = 526 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -3 Query: 352 DDLQVASKDVFYDLVLKWARIHYPKLEEEERQEILGQRLSRVIRFPY 212 DDLQVAS+D YD VLKWARIHYPKL E+R+EILG RL R+IRFPY Sbjct: 276 DDLQVASEDAVYDFVLKWARIHYPKL--EDRREILGSRLGRLIRFPY 320 >ref|XP_002509901.1| atpob1, putative [Ricinus communis] gi|223549800|gb|EEF51288.1| atpob1, putative [Ricinus communis] Length = 734 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -3 Query: 352 DDLQVASKDVFYDLVLKWARIHYPKLEEEERQEILGQRLSRVIRFPY 212 DDLQVAS+D YD VLKWARIHYPKL EERQE+L RL R+IRFP+ Sbjct: 312 DDLQVASEDAVYDFVLKWARIHYPKL--EERQEVLASRLGRLIRFPF 356 >emb|CBI40464.3| unnamed protein product [Vitis vinifera] Length = 501 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = -3 Query: 352 DDLQVASKDVFYDLVLKWARIHYPKLEEEERQEILGQRLSRVIRFPY 212 DDLQVAS+D YD VLKWAR YPKL EER+EILG RL R IRFPY Sbjct: 251 DDLQVASEDAVYDFVLKWARAQYPKL--EERREILGTRLGRFIRFPY 295